PRGDB00065850 (At.389)

From PRG Wiki
Jump to: navigation, search
At.389
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30686872 (NM_113200)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CIPK7 (CBL-INTERACTING PROTEIN KINASE 7); ATP binding

DNA Sequence

GTCCCTGAAACCTCTCTTCAGAAAACTCAGGCACCATTTTCTCCTTCCGCCGCCGCCATGGAATCACTTCCCCAGCCGCAAAACCAATCATCTCCGGCAACAACTCCGGCGAAGATCCTCCTTGGGAAATACGAACTCGGTCGTCGTCTCGGTAGCGGAAGCTTCGCGAAAGTCCATTTAGCTCGATCAATCGAATCCGACGAGCTCGTCGCCGTTAAAATCATCGAGAAGAAGAAAACAATCGAATCCGGTATGGAACCAAGAATAATCAGAGAGATCGATGCGATGCGTCGTCTTCGTCATCATCCAAACATACTCAAGATCCATGAAGTTATGGCAACCAAATCTAAGATCTATCTCGTAATGGAACTCGCTTCCGGTGGTGAACTTTTCTCAAAAGTCCTCCGTCGTGGACGTCTTCCTGAATCAACGGCGCGTCGTTACTTTCAACAACTCGCCTCCGCTCTTCGTTTCTCTCACCAAGACGGTGTCGCTCACCGTGATGTGAAACCTCAGAATCTACTCTTAGATGAGCAAGGTAACCTCAAGGTCTCTGACTTTGGTTTATCAGCTTTACCGGAGCATCTACAAAACGGATTGCTTCACACGGCGTGTGGTACTCCGGCTTATACAGCTCCGGAGGTTATTTCACGGAGGGGATACGACGGAGCAAAAGCTGATGCGTGGTCTTGTGGTGTGATTTTGTTTGTTTTATTGGTTGGCGATGTTCCATTTGATGATTCGAATATCGCTGCGATGTATCGGAAGATTCATCGGAGAGATTATCGGTTTCCGAGCTGGATTTCGAAACAAGCTAAATCGATAATCTATCAGATGTTAGATCCGAATCCAGTAACGAGGATGAGTATTGAAACAGTGATGAAAACGAATTGGTTCAAGAAGTCTCTAGAGACTTCTGAGTTTCATCGTAACGTCTTTGATTCGGAAGTAGAGATGAAATCGAGTGTTAATTCGATTACTGCTTTTGATTTGATCTCGTTATCGTCGGGATTAGATCTTTCTGGATTGTTTGAGGCTAAGAAGAAGAAGGAGAGGAGATTCACGGCGAAGGTTTCGGGTGTTGAAGTGGAGGAGAAGGCGAAGATGATTGGGGAGAAGTTAGGTTATGTagtgaagaagaagatgatgaagaaggaaggagaagtgaagGTTGTTGGATTAGGGAGAGGAAGAACTGTGATTGTGGTGGAAGCAGTGGAGTTAACGGTGGATGTTGTGGTGGTTGAAGTGAAAGTTGTTGAAGGTGAAGAAGATGATTCACGGTGGTCTGATTTGATTACTGAGCTTGAAGATATAGTTCTTTCATGGCACAATGACATCATGTAAATAGATTGTGActttgtggattttagtctcttttttgttttgtttctgttcagttttGTATAATCCATGAAGAAATCAAAATCTCCCGCTTCATTGTCTTTTTACCAGCAGATACATTACCCTCTCTGCTACCGATTCCATAAGCTTTGATCACTACATGGTACTCAATAATGATTCTCTTATTCGCT


Protein sequences

Name Description Sequence
At.389 translated coding region predicted by ESTScan from UniGene At.389

VPETSLQKTQAPFSPSAAAMESLPQPQNQSSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEMKSSVNSITAFDLISLSSGLDLSGLFEAKKKKERRFTAKVSGVEVEEKAKMIGEKLGYVVKKKMMKKEGEVKVVGLGRGRTVIVVEAVELTVDVVVVEVKVVEGEEDDSRWSDLITELEDIVLSWHNDIM

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
22-143 no description

SLPQPQNQSSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPES

superfamily: SSF56112
IPR011009
30-330 Protein kinase-like (PK-like)
Protein kinase-like domain

SSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEMKSSVNSITAFD

HMMPanther: PTHR24343:SF130
38-332 SUBFAMILY NOT NAMED

KILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEMKSSVNSITAFDLI

HMMPanther: PTHR24343
38-332 FAMILY NOT NAMED,SERINE/THREONINE KINASE

KILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEMKSSVNSITAFDLI

ProfileScan: PS50011
IPR000719
44-299 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWF

HMMPfam: PF00069
IPR017442
44-299 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWF

HMMSmart: SM00219
IPR020635
44-299 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWF

HMMSmart: SM00220
IPR002290
44-299 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRLRHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWF

PatternScan: PS00107
IPR017441
50-73 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGSFAKVHLARSIESDELVAVK

Gene3D: G3DSA:1.10.510.10
144-305 no description

TARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQGNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHRRDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLET

PatternScan: PS00108
IPR008271
164-176 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VAHRDVKPQNLLL

ProfileScan: PS50816
IPR018451
321-345 NAF
NAF/FISL domain

SSVNSITAFDLISLSSGLDLSGLFE

HMMPfam: PF03822
IPR004041
323-380 NAF
NAF domain

VNSITAFDLISLSSGLDLSGLFEAKKKKERRFTAKVSGVEVEEKAKMIGEKLGYVVKK

Seg: seg
330-343 seg

DLISLSSGLDLSGL

Seg: seg
373-398 seg

KLGYVVKKKMMKKEGEVKVVGLGRGR

Seg: seg
400-424 seg

VIVVEAVELTVDVVVVEVKVVEGEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox