PRGDB00065851 (At.441)

From PRG Wiki
Jump to: navigation, search
At.441
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145336863 (NM_104619)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (CC-NBS-LRR class), putative (AT1G58390) mRNA, complete cds

DNA Sequence

CTGAATTAAGCATCCCTGTTTCTCCTAAAGAGCGACAACAGAAGAGTTCCTCGACGCCATCAAGAGGAGCAACTATGGCTGGAGAACTTGTGTCGTTTGGAATAAAAAAGCTTTGGGACCTACTGAGTCAAGAATGCGAGCAATTTCAGGGAGTTGAAGATCAAGTTACTGGACTAAAACGTGATCTAAACTTGTTAAGCTCTTTTCTAAAAGATGCAGATGCAAAGAAACATACAACTGCGGTGGTGAGAAATGTTGTCGAAGAAATAAAGGAAATTGTTTACGACGCAGAAGATATAATTGAAACATATCTTCTTAAAGAAAAACTTTGGAAAACAAGTGGAATCAAGATGCGTATCAGAAGACATGCTTGCATTATTTCAGATCGTAGGAGAAATGCATTAGATGTTGGAGGCATACGTACGAGGATCTCGGATGTGATCCGAGATATGCAGAGTTTTGGAGTGCAACAAGCTATCGTTGATGGTGGTTATATGCAACCTCAAGGTGATAGACAAAGGGAGATGCGACAAACGTTTTCTAAGGACTACGAAAGCGATTTTGTGGGGTTGGAGGTAAATGTTAAGAAACTGGTTGGATATTTGGTGGACGAAGAAAACGTTCAAGTGGTTTCCATAACCGGGATGGGTGGTCTAGGTAAAACCACACTTGCTAGACAGGTTTTTAACCATGAGGATGTTAAACATCAGTTTGATAGACTCGCATGGGTGTGTGTCTCACAAGAGTTTACTCGGAAGAATGTATGGCAAATGATCTTGCAGAATCTAACCTCTAGAGAAAAGAAAGATGAAATCTTGCAAATGGAAGAAGCTGAACTCCATGATAAACTCTTTCAGCTATTGGAGACATCTAAATCATTAATTGTCTTTGATGACATATGGAAAGACGAAGATTGGGACCTAATAAAGCCAATATTTCCACCCAATAAAGGTTGGAAGGTGCTTCTTACTTCTCAAAATGAGAGTGTCGCGGTACGTGGGGATATAAAATATCTCAACTTTAAACCAGAATGCCTAGCCATTGAGGATAGTTGGACACTTTTCCAAAGAATAGCATTTCCAAAGAAAGATGCATCTGAATCTAAGGTTGACGAGGAAATGGAAGATATGGGTAAGCAAATGTTAAAACATTGTGGAGGGCTACCATTAGCCATCAAAGTGTTAGGAGGTTTGTTAGCTGCAAAGTACACAATGCATGATTGGGAAAGACTATCCGTAAATATCGGATCTGATATCGTGGGAAGAACCAGCAGTAACAACAGTTCAATATACCATGTATTGTCTATGAGCTTTGAGGAGTTGCCTAGTTATTTGAAACATTGTTTCCTCTACCTGGCCCATTTTCCAGAAGATCATAAGATTAACGTGGAGAAATTGTCTTATTGTTGGGCTGCAGAAGGAATATCCACCGCCGAAGATTATCACAATGGAGAGACCATTCAAGATGTTGGACAGAGCTACCTAGAGGAGTTAGTGAGGAGGAATATGATAATTTGGGAAAGAGATGCTACTGCTTCGAGATTTGGAACTTGTCATTTGCATGACATGATGAGAGAAGTTTGTTTGTTTAAAGCCAAGGAAGAAAACTTCCTACAAATTGCTGTAAAAAGTGTAGGTGTAACCAGCTCCTCGACCGGAAACTCTCAATCTCCTTGTAGATCTCGCAGGCTTGTCTACCAATGTCCAACTACATTACATGTTGAGAGAGATATAAACAATCCAAAACTTAGATCTCTCGTGGTTCTCTGGCATGATTTATGGGTAGAAAATTGGAAGCTATTAGGTACAAGCTTTACAAGGTTAAAACTTCTGAGAGTGTTAGATCTCTTTTATGTAGATTTTGAAGGAATGAAGTTACCTTTTGGCATTGGAAACCTCATCCACTTACGATACTTGAGCTTACAAGATGCTAAGGTATCTCATCTACCTTCTTCTCTAGGAAACCTAATGTTACTGATCTATCTAAATTTAGATGTCGATACGGAATTTATATTCGTGCCGGATGTCTTCATGAGGATGCATGAATTGAGATACCTTAAACTACCGTTACATATGCACAAGAAGACAAGGTTGAGTTTGAGAAATCTAGTAAAGTTGGAGACCTTGGTTTATTTCTCAACATGGCATAGTAGCTCAAAGGATCTATGTGGTATGACCAGATTGATGACTCTTGCTATCAGATTAACTCGTGTGACGAGTACAGAAACTCTATCGGCATCAATAAGTGGACTGAGAAACCTTGAATATCTTTATATTGTGGGTACTCACTCTAAAAAAATGAGAGAAGAGGGTATTGTACTGGATTTCATTCATCTCAAACATCTATTGTTGGATTTATATATGCCAAGGCAACAACACTTCCCTTCTCGACTAACATTCGTAAAGCTAAGTGAGTGTGGCTTGGAGGAGGATCCAATGCCTATTCTAGAGAAGCTGCTTCACTTGAAAGGTGTTATTTTATTGAAAGGCTCTTACTGTGGGAGGAGGATGGTTTGCTCGGGTGGCGGGTTTCCTCAGTTGAAGAAGCTTGAAATAGTTGGACTAAATAAGTGGGAAGAGTGGCTAGTAGAAGAAGGCTCCATGCCACTTCTTGAAACTCTGAGTATTTTGGATTGTGAAGAGTTAAAGGAGATTCCTGATGGGCTGAGATTCATCTATTCTTTAGAGCTTGTGATGTTGGGCACCAGATGGAAGAAGAAATTTTCTGTAGGAGGAGAAGATTATTACAAAGTACAACACATTCCTTCCGTTGAATTCATAGGAGGCTACCTCAAATGA


Protein sequences

Name Description Sequence
At.441 translated coding region predicted by ESTScan from UniGene At.441

XELSIPVSPKERQQKSSSTPSRGATMAGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFIGGYLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF233
27-927 DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFI

HMMPanther: PTHR23155
27-927 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFI

superfamily: SSF52540
171-423 P-loop containing nucleoside triphosphate hydrolases

DRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRT

HMMPfam: PF00931
IPR002182
193-480 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAED

Gene3D: G3DSA:3.40.50.300
205-329 no description

EENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNES

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
385-399 DISEASERSIST
Disease resistance protein

CGGLPLAIKVLGGLL

superfamily: SSF52058
519-900 L domain-like,LRR

HLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVML

Seg: seg
544-557 seg

SVGVTSSSTGNSQS

Seg: seg
653-664 seg

LGNLMLLIYLNL

Gene3D: G3DSA:3.80.10.10
800-897 no description

FVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLEL

FPrintScan: PR00364
IPR000767
866-882 DISEASERSIST
Disease resistance protein

GSMPLLETLSILDCEEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox