PRGDB00065865 (At.1601)

From PRG Wiki
Jump to: navigation, search
At.1601
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357588 (NM_120410)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase, putative (AT5G03320) mRNA, complete cds

DNA Sequence

AAACCTTTGACTTCAAATTTGTTCTTCCTCTTATTAGTCTTCGTCATATTTTCTTCCTTCTTCCATCTTTTAGTTCTGATAAGTTAACATTTTCATAAGACCTCAAAAATAGCTCCTACATTTGTTATCTTCCTTTTCAAGTCAACAATAtttttttttGTTCTGTTATCAAAGACTCCTTCTTTTGGTGATTAAACTCTGTTCAACTTCTGAAAAAAAGTTTTGATTTTTCTTTTGTCTGTAGTACACAAAGATCTCAAAGTGGAGGAACCTCGGTGTTTTAACATCTTTACGAAGATGAAATGCTTCTTATTCCCTCTTGGGGACAAGAAAGATGAACAGAGAAGCCCTAAACCGGTTTCACCAACGTCTAACTTCAGTGACGTAAACAAAAGCGGTTCAGATTTCAGTCCCCGGGATGTTTCTGGAACGAGCACAGTATCATCCACTGGTAGGAACTCGAACACTAGCATGTCAGCTAGAGAAAACAACCTTAGAGAGTTCACTATTGGTGATCTTAAATCTGCCACAAGGAACTTCAGCAGGTCAGGTATGATCGGGGAAGGCGGTTTTGGTTGTGTCTTCTGGGGAACAATCAAGAACTTAGAAGACCCATCGAAGAAAATCGAAGTCGCGGTTAAACAGCTCGGCAAAAGAGGGTTGCAGGGTCATAAAGAATGGGTGACTGAAGTGAACTTTCTCGGTGTAGTCGAGCATTCAAACTTGGTGAAGTTGCTGGGACATTGTGCAGAAGACGATGAACGTGGAATCCAAAGGCTTTTGGTTTATGAATATATGCCAAACCAAAGTGTCGAGTTCCATTTATCTCCGCGGTCACCGACAGTACTTACTTGGGACCTCAGATTGAGAATAGCACAAGACGCAGCTCGAGGTTTAACATACCTTCATGAAGAAATGGACTTTCAGATAATATTCCGTGATTTCAAGTCATCCAACATTCTACTAGACGAGAATTGGACAGCGAAGCTTTCGGATTTCGGTTTGGCTCGCTTAGGTCCTTCACCAGGATCCAGCCATGTTTCTACTGATGTAGTAGGAACAATGGGATACGCAGCTCCAGAGTATATCCAAACGGGTCGCCTCACGTCGAAAAGCGATGTGTGGGGATACGGAGTTTTCATCTATGAGCTCATTACAGGAAGAAGGCCACTAGACCGGAACAAGCCTAAAGGAGAGCAGAAGCTTTTAGAATGGGTGAGACCTTACTTATCCGACACAAGGAGGTTCCGGCTAATAGTAGACCCGAGGCTCGAGGGAAAGTACATGATCAAGTCAGTGCAGAAACTCGCGGTTGTAGCCAACCTTTGCCTTACTAGAAACGCAAAGGCGCGTCCAAAGATGAGCGAGGTGTTAGAGATGGTGACAAAGATTGTGGAAGCTTCATCGCCTGGGAATGGTGGCAAGAAGCCGCAGCTGGTTCCACTAAAGAGTCAAGAAACTTCTAGAGTCGAGGAAGGGAAGAATAAGAAGGTTCTTGATGGTGCTGAAGGAGGTTGGTTAGAAAAGTTGTGGAACCCAAAGAATGTGAGAGCTTGTTGATTCGGGGTCTACGTCAGAAACAAATTAGTGAATTTCAATGCCTTTGTTTAAATACTGTAATTTAACAAACTTATGAGTTTTCTTACATTCCATTTTTTGGTGTGATTATTAAACGATTTATTTGATATTCGAGTGATTTCGAAGATTTTTGCAGAA


Protein sequences

Name Description Sequence
At.1601 translated coding region predicted by ESTScan from UniGene At.1601

MKCFLFPLGDKKDEQRSPKPVSPTSNFSDVNKSGSDFSPRDVSGTSTVSSTGRNSNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASSPGNGGKKPQLVPLKSQETSRVEEGKNKKVLDGAEGGWLEKLWNPKNVRACXFGVYVRNKLVNFNAFV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF642
9-427 PROTEIN KINASE, PUTATIVE

GDKKDEQRSPKPVSPTSNFSDVNKSGSDFSPRDVSGTSTVSSTGRNSNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASSPGNGGKKPQLVPLKSQETSRVEEGKNKKVLDGAEGGWLEKLWNPKNVRACXFGVYVR

HMMPanther: PTHR24420
9-427 FAMILY NOT NAMED,FAMILY NOT NAMED

GDKKDEQRSPKPVSPTSNFSDVNKSGSDFSPRDVSGTSTVSSTGRNSNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASSPGNGGKKPQLVPLKSQETSRVEEGKNKKVLDGAEGGWLEKLWNPKNVRACXFGVYVR

Seg: seg
42-58 seg

VSGTSTVSSTGRNSNTS

superfamily: SSF56112
IPR011009
51-362 Protein kinase-like (PK-like)
Protein kinase-like domain

TGRNSNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMV

Gene3D: G3DSA:3.30.200.20
60-167 no description

SARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYM

ProfileScan: PS50011
IPR000719
81-366 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIV

HMMSmart: SM00220
IPR002290
81-366 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIV

HMMSmart: SM00219
IPR020635
81-362 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSRSGMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMV

HMMPfam: PF00069
IPR017442
85-360 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

GMIGEGGFGCVFWGTIKNLEDPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLVYEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLE

PatternScan: PS00107
IPR017441
87-115 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGCVFWGTIKNLEDPSKKIEVAVK

Gene3D: G3DSA:1.10.510.10
183-383 no description

VLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVFIYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVVANLCLTRNAKARPKMSEVLEMVTKIVEASSPGNGGKKPQLVPL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox