PRGDB00065878 (At.3179)

From PRG Wiki
Jump to: navigation, search
At.3179
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79315443 (NM_001035802)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT3G57760) mRNA, complete cds

DNA Sequence

AGGTACAATTTCAATTCTGAGTTCAATTTCGTAGACATTATTAGAGTACCAATGATTTGAAATATTCTCTCTTTATTTCAGCTGTTGAGAGTGGATTAATGGAGTTCCTCTGAGGAGTTTACACACATTAAATCTGGTGCTCTTAAGGATAAATCTTGTAGAGAGTCTTTACGATGGATTGGTTGAGAACAAAAAGAATCAGAGCCAAGAAAAGGAAGAGGAATGTCAAAGAGAATGGCGAGGTTGTTCTAAAAGAGCTCATTGAATGTTGTGATGGAAAATGCAATCCTATCAAGAACTTCTCTTACGACCAGATCATCAAAGCAACAAATAACTTCTGCCAAAGTAACCGTGCTTCTCGGATTGATGTTTATTACCGTTGCTATAAAGGCATGCTTGATGACCGGCCAGTGCTCATCAAGAAAGGGAAATACACACTTGATATGAAAGAGATTTGTCGCGACATAGCTATCTCATCGATGGTTAGTGGTCATAAGAACTTCCTCAAACTATTGGGATGTTGTCTTGAGTTCACTCCTCCTGTCTTAGTTTTTGAGTATGCAGAGGTTATAACTCTTGGTCCATTGCTTACATCTCATCCGGGATATCTGAGGAGGATAAAGATAGCAAGAGAGGTCGCAAATGCTTTGACTTACCTTCACACAGCATTCTCAAGAGTTTTCATCCATTCGAATCTAGATCCTTTCACCATTTTCTTAGATGGAAATGGGGTCGCAAAGCTCGGGAATTTCTGCAACTGTATCACAATTCCAGAAGGAGAGACATTTGTTCATGATGATACATTACAGAAATACCATGAGTTGAGGCATAATACATTAAAGGGGACACATGGGCTTGGTGTATGTAACTTACCGGTCATTGATCCCGACTACAAATCAACCGGTAAAGTCACGACAAAGACTGATATGCACAGCTTTGGAGGATTCATGCTAGCTCTTGTGCAGATAAGGGAAGTTGATGATGAGCTATCTCTATCTTCGGATATGCTGAGAGCATTAGCTGACTTGTTCATCAAACCTTATGATGATGTTCGCTATGTTCACTTCCCGCTTCACCATCATGTTTCTAAGATACTGAGGAAGTTTGGGTATGCAGAGGTTGTAGATTCAGATATGAGCGAGGTAGCTGCTTGGCCAATTAAAGCCTTTCTTAGATTAGCGTTGAGATGCATTGGATGCAAGTTGGGAGACCCGTTGAGTAGCATGATTCAAGTGACGAAAGAGCTCAGGCTGATTGAGAAATCTGCATATTATCCATCAAACAACAGATCACAGATGAGCTCCATATGACAGGATTCTTTTTGTAGTCAAACATTAAACCAGGAATGTTATTATAGTAGCTTCAGTCTGAAACATTAACATTCAGATTTTTCCCAATAGAAAAAGCAAAATGTTCACAGATTTGCTTCTGTT


Protein sequences

Name Description Sequence
At.3179 translated coding region predicted by ESTScan from UniGene At.3179

MDWLRTKRIRAKKRKRNVKENGEVVLKELIECCDGKCNPIKNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQIREVDDELSLSSDMLRALADLFIKPYDDVRYVHFPLHHHVSKILRKFGYAEVVDSDMSEVAAWPIKAFLRLALRCIGCKLGDPLSSMIQVTKELRLIEKSAYYPSNNRSQMSSI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF734
1-362 PTHR24420:SF734

MDWLRTKRIRAKKRKRNVKENGEVVLKELIECCDGKCNPIKNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQIREVDDELSLSSDMLRALADLFIKPYDDVRYVHFPLHHHVSKILRKFGYAEVVDSDMSEVAAWPIKAFLRLALRCIGCKLGDPLSSMIQVTKELRLIE

HMMPanther: PTHR24420
1-362 PTHR24420,FAMILY NOT NAMED

MDWLRTKRIRAKKRKRNVKENGEVVLKELIECCDGKCNPIKNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQIREVDDELSLSSDMLRALADLFIKPYDDVRYVHFPLHHHVSKILRKFGYAEVVDSDMSEVAAWPIKAFLRLALRCIGCKLGDPLSSMIQVTKELRLIE

ProfileScan: PS50011
IPR000719
34-378 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DGKCNPIKNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQIREVDDELSLSSDMLRALADLFIKPYDDVRYVHFPLHHHVSKILRKFGYAEVVDSDMSEVAAWPIKAFLRLALRCIGCKLGDPLSSMIQVTKELRLIEKSAYYPSNNRSQMSSI

Gene3D: G3DSA:3.30.200.20
39-117 G3DSA:3.30.200.20

PIKNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCC

superfamily: SSF56112
IPR011009
41-362 Kinase_like
Protein kinase-like domain

KNFSYDQIIKATNNFCQSNRASRIDVYYRCYKGMLDDRPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQIREVDDELSLSSDMLRALADLFIKPYDDVRYVHFPLHHHVSKILRKFGYAEVVDSDMSEVAAWPIKAFLRLALRCIGCKLGDPLSSMIQVTKELRLIE

HMMPfam: PF07714
IPR001245
78-263 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

RPVLIKKGKYTLDMKEICRDIAISSMVSGHKNFLKLLGCCLEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALV

Gene3D: G3DSA:1.10.510.10
118-264 G3DSA:1.10.510.10

LEFTPPVLVFEYAEVITLGPLLTSHPGYLRRIKIAREVANALTYLHTAFSRVFIHSNLDPFTIFLDGNGVAKLGNFCNCITIPEGETFVHDDTLQKYHELRHNTLKGTHGLGVCNLPVIDPDYKSTGKVTTKTDMHSFGGFMLALVQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox