PRGDB00065883 (At.4452)

From PRG Wiki
Jump to: navigation, search
At.4452
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 27311836 (BT002524)
Gene Class TN
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Unknown protein mRNA, complete cds

DNA Sequence

ATCTTCTTTCTATAGTTTCCATGAAGTCTTCTTCTTCTCAGAGCTACGATGTTTTCCCCAACTTCAGAGGGGAAGATGTCCGCCACTCATTAGTCAGCCACCTTCGTAAGGAACTTGATCGCAAATTCATCAATACATTCAACGACAACAGGATCGAAAGAAGCCGCAAAATAACCCCAGAGCTGTTATTGGCTATAGAAAACTCAAGGATCTCACTTGTCGTCTTCTCTAAAAACTATGCTTCTTCCACGTGGTGCTTAGATGAATTGGTGAAGATCCAAGAGTGCTATGAGAAATTGGATCAAATGGTGATTCCTATTTTCTACAAAGTAGATCCTTCTCATGTTAGAAAACAGACCGGAGAGTTTGGCATGGTCTTTGGGGAGACCTGCAAGGGCAGAACAGAGAATGAGAAGCGAAAATGGATGCGAGCTCTAGCAGAGGTAGCACATCTAGCCGGAGAAGATCTTCGGAACTGGCGTAGCGAAGCAGAAATGCTTGAAAATATCGCCAAGGATGTTTCAAACAAACTCTTCCCCCCATCAAATAATTTCAGTGACTTCGTCGGGATTGAAGCTCATATAGAGGCATTGATATCAATGTTGCGCTTCGACTCCAAGAAAGCGCGAATGATAGGGATTTGTGGGCCTTCTGAAACTGGTAAGACTACTATAGGAAGAGCTTTATACAGCAGACTCAAAAGCGACTTCCACCATCGGGCTTTCGTAGCATATAAGAGAAAAATACGGAGCGACTATGACCAGAAGCTGTATTGGGAAGAACAATTTCTATCAGAAATTCTTTGTCAGAAGGATATAAAGATAGAGGAATGTGGTGCGGTGGAACAACGACTAAAGCACACGAAAGTTCTTATTGTTCTTGATGATGTTGATGATATAGAGCTACTAAAAACGTTGGTAGGACGTATCAGATGGTTTGGATCTGAGAGCAAAATTGTTGTGATTACTCAAAAAAGGGAACTTCTCAAGGCTCACAACATTGCACATGTTTATGAAGTGGGATTCCCATCAGAAGAACTGGCTCATCAAATGTTTTGTCGATATGCTTTTGGGAAAAACTCTCCACCTCATGGTTTCAACGAGCTTGCAGATGAAGCTGCAAAGATTGCCGGTAATCGTCCTAAAGCTCTCAAGTACGTTGGTTCGTCTTTTAGAAGACTAGACAAGGAACAATGGGTGAAGATGCTATCGGAGTTCCGTAGTAATGGGAATAAACTAAAAATCAGCTATGATGAGTTAGATGGTAAAGGTCAAGATTACGTTGCGTGTTTAACCAATGGTTCAAATTCCCAGGTGAAGGCAGAGTGGATCCACTTGGCACTAGGCGTGTCTATATTACTTAACATCCGCAGTGACGGAACGACAATTCTCAAACATTTGAGCTACAATCGAAGCATGGCGCAACAAGCAAAAATATGGTGGTATGAAAATTTGGAAAGAGTGTGCAAGAAGTACAATATATGTGGCATAGATAGCTCAACTAATGGTGGTGGTAAGAAAGTTTGCTACGTTGGGATATACCCCTATGTTTTAATACAATATCGTATTGCGGGACGATATTGATAGTATAAAAACGGCTAGGAGATAGGTTAAGTCTCTCGTACTGGCCCATTCGTTTCCACGTTTTCGATGAAGATCTGGATAAGAATACATCTTATGTTGTTAGTTTTTTCCAATTTGGTATTTGCATTTAGATGGTGCATGCAAACCCAATTGTGTACCAAAAAATTCTAGATATTTTGGATGCACAAAAAACTATATCACATCACATGCAATGCATAACTCTCTTGCTTCACATTAGCTATGCATGCAATGCAGGTTCAACGTATGGACAATGTTCAAATTCCCAATTTCAAAGAAACATGGACGCAAGCCCCGGGGGAAACAAAACCAGTAATCAATCCACAAAAGATTCACCGAGAGCTTCTCAAGTAGAGAAGGAAAAGATCGAGTACTGTGAGCCACATGTATATATAACACCTGCCATCTTCAGTGACGGAACCAGAGCTCCCAAATACGTGGAGTCTAGGTAACGTGAAATCTAATCTTTCACAATATATAAGTATACTTTCTTTTCACATCGTAGAATCTTAAGTAGTAACTTGGAACTAGGATTCTATATCAATCAATCTTTCAACAAGTGGTTGTTTGTACTTAGTAGCCGAAGAGTAACCCAAGTGCACCACGCCAAAACATGGTGGCCGGAGAATTGTGAAAAAGTGTACGAGAACCACAACAACATATATGGCATAGATAGATCAATTGACGGTGGTGATAAGTTTGAGGGAAAAAGTAAAGTTAGTGACGGTGGGTTAGACGGCAAAGATCAAGGTTCAATGTATGGACAAAGTTCAAATTCCGAGCTTCAAATAAACATGGACGCAGACAATAGGAGATGTGAACCTGTGAGTGAGATGCTTTTCAAAAATTACAATGTGTGTTCGCCTAATGGTAAGGGAAGTGATATTTGAAAATTGCGCATGACGATATTGTTATCTGGACTTACAATTCTTACTGATAAGTCCCTCAAGCACATATGCCTGCAGGTTTAACCGATGTAAACTGTTCAAATCCCCAGTCTCAAAGAAAATTGGACGCAAGCCTAAAGAAAGACAAAATTGTGCATGAGTGGATTCGAACCGGTAGTGGCTTCTTTTTTGATTTTCAGGGCCCAAAATCTATAGTGAGTGCTGCTCAAGTGGACGAGAAAAATTTCGAGTACTGTGAACAAGGTGTGTATATAACACTTGGCATCCTCAGTGGCGGAATTATAGTTCTCAAACATTTGGAGTTCAGCCGAAGAATGGCGCAACAAGCAAAAGTTTGGTGGTCGGAAAATTGGATAAAAGTGTACCAGGAGCACAACATATGTGGCATAGATAAATCATTTGATGGTAGGTTTGATGATAGACGTGTCATTCGTCAATTAAGACCAAACTGAAGCACGGCCTGGCCCTTGTAAAAGTCAGGACTTGAGCTAGATACTTAAGCCAAGCAGATCTGTTTGGCTAAGTCTGGTCGGGTTAGCGCGAAATTGTCGAAATCTGTTTAATAATTGCATTCAGTGCAAGTCTTTAATTTGTACTTCATGGCTTTAATACACTAATTAAACATTGGATCATTTTTAG


Protein sequences

Name Description Sequence
At.4452 translated coding region predicted by ESTScan from UniGene At.4452

XLLSIVSMKSSSSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGEDLRNWRSEAEMLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDELDGKGQDYVACLTNGSNSQVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYNICGIDSSTNGGGKKVCYVGIYPYVXNTISYCGTILIVXKRLGDRLSLSYWPIRFHVFDEDLDKNTSYVVSFFQFGICIXMVHANPIVYQKILDILDAQKTISHHMQCITLLLHISYACNAGSTYGQCSNSQFQRNMDASPGGNKTSNQSTKDSPRASQVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESRXREIXSFTIYKYTFFSHRRILSSNLELGFYINQSFNKWLFVLSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGKGSDXLKIAHDDIVIWTYNSYXXVPQAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
4-155 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

SIVSMKSSSSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGE

Seg: seg
4-15 seg

SIVSMKSSSSQS

Gene3D: G3DSA:3.40.50.10140
12-150 no description

SSQSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVA

ProfileScan: PS50104
IPR000157
14-152 TIR
Toll-Interleukin receptor

QSYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHL

HMMSmart: SM00255
IPR000157
15-152 Toll
Toll/interleukin-1 receptor homology (TIR) domain

SYDVFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHL

HMMPfam: PF01582
IPR000157
18-147 TIR
Toll-Interleukin receptor

VFPNFRGEDVRHSLVSHLRKELDRKFINTFNDNRIERSRKITPELLLAIENSRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALA

superfamily: SSF52540
69-403 P-loop containing nucleoside triphosphate hydrolases

SRISLVVFSKNYASSTWCLDELVKIQECYEKLDQMVIPIFYKVDPSHVRKQTGEFGMVFGETCKGRTENEKRKWMRALAEVAHLAGEDLRNWRSEAEMLENIAKDVSNKLFPPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKML

Coil: coil
157-178 coiled-coil

LRNWRSEAEMLENIAKDVSNKL

Gene3D: G3DSA:3.40.50.300
180-331 no description

PPSNNFSDFVGIEAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKA

HMMPfam: PF00931
IPR002182
192-420 NB-ARC,NBS
NB-ARC

EAHIEALISMLRFDSKKARMIGICGPSETGKTTIGRALYSRLKSDFHHRAFVAYKRKIRSDYDQKLYWEEQFLSEILCQKDIKIEECGAVEQRLKHTKVLIVLDDVDDIELLKTLVGRIRWFGSESKIVVITQKRELLKAHNIAHVYEVGFPSEELAHQMFCRYAFGKNSPPHGFNELADEAAKIAGNRPKALKYVGSSFRRLDKEQWVKMLSEFRSNGNKLKISYDEL

FPrintScan: PR00364
IPR000767
211-226 DISEASERSIST
Disease resistance protein

MIGICGPSETGKTTIG

FPrintScan: PR00364
IPR000767
284-298 DISEASERSIST
Disease resistance protein

RLKHTKVLIVLDDVD

Seg: seg
290-303 seg

VLIVLDDVDDIELL

FPrintScan: PR00364
IPR000767
377-391 DISEASERSIST
Disease resistance protein

AGNRPKALKYVGSSF

HMMPfam: PF08381
IPR013591
438-493 BRX
Brevis radix-like domain

QVKAEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

ProfileScan: PS51514
IPR013591
441-493 BRX
Brevis radix-like domain

AEWIHLALGVSILLNIRSDGTTILKHLSYNRSMAQQAKIWWYENLERVCKKYN

HMMPfam: PF08381
IPR013591
651-684 BRX
Brevis radix-like domain

QVEKEKIEYCEPHVYITPAIFSDGTRAPKYVESR

HMMPanther: PTHR22870:SF61
652-987 DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS CLASS)

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESRXREIXSFTIYKYTFFSHRRILSSNLELGFYINQSFNKWLFVLSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGKGSDXLKIAHDDIVIWTYNSYXXVPQAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

HMMPanther: PTHR22870
652-987 FAMILY NOT NAMED,REGULATOR OF CHROMOSOME CONDENSATION

VEKEKIEYCEPHVYITPAIFSDGTRAPKYVESRXREIXSFTIYKYTFFSHRRILSSNLELGFYINQSFNKWLFVLSSRRVTQVHHAKTWWPENCEKVYENHNNIYGIDRSIDGGDKFEGKSKVSDGGLDGKDQGSMYGQSSNSELQINMDADNRRCEPVSEMLFKNYNVCSPNGKGSDXLKIAHDDIVIWTYNSYXXVPQAHMPAGLTDVNCSNPQSQRKLDASLKKDKIVHEWIRTGSGFFFDFQGPKSIVSAAQVDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHNICGIDKSFDGRFDDRRVIRQLRPN

ProfileScan: PS51514
IPR013591
654-753 BRX
Brevis radix-like domain

KEKIEYCEPHVYITPAIFSDGTRAPKYVESRXREIXSFTIYKYTFFSHRRILSSNLELGFYINQSFNKWLFVLSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPfam: PF08381
IPR013591
726-753 BRX
Brevis radix-like domain

LSSRRVTQVHHAKTWWPENCEKVYENHN

HMMPfam: PF08381
IPR013591
908-963 BRX
Brevis radix-like domain

VDEKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN

ProfileScan: PS51514
IPR013591
910-963 BRX
Brevis radix-like domain

EKNFEYCEQGVYITLGILSGGIIVLKHLEFSRRMAQQAKVWWSENWIKVYQEHN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox