PRGDB00065888 (At.4975)

From PRG Wiki
Jump to: navigation, search
At.4975
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357562 (NM_120358)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G02800) mRNA, complete cds

DNA Sequence

TTGGCTTGGCGTGCTTTTTTTACATTTCAAAGTTCTCTAAGCTtctctctctctctctcGCTTTTGAGATCATCGAACACAATCGAAACGAAGAATCATTTGAAGAAGAAGAAGATCGTGAGAAGCTTAATGGGTTGGATCCCGTGTTCTGGGAAATCGAGTGGGAGGAATAAGACAAGGAGGAACGGTGACCACAAACTCGACAGGAAGTCTTCTGATTGTTCTGTGTCTACTTCAGAGAAATCTAGGGCCAAGTCGTCCTTGAGTGAATCCAAAAGTAAAGGCTCTGATCACATTGTGGCACAAACGTTTACATTCTCTGAGTTAGCTACTGCCACTAGAAACTTCAGAAAAGAATGTCTTATAGGAGAAGGAGGATTTGGTAGAGTTTACAAAGGATACTTGGCCAGCACTAGCCAGACAGCGGCTATCAAGCAACTTGATCATAATGGTTTACAAGGAAACAGGGAGTTCCTCGTCGAGGTTCTCATGTTGAGTCTTCTTCATCACCCGAATCTTGTTAACTTAATAGGATATTGTGCTGATGGAGATCAAAGGCTTCTAGTCTACGAGTACATGCCCCTAGGTTCACTTGAAGATCATTTGCACGACATTTCACCTGGTAAGCAGCCACTTGACTGGAACACCAGAATGAAAATAGCTGCCGGTGCTGCAAAAGGTTTGGAGTATCTGCATGACAAAACCATGCCTCCAGTGATCTATCGAGATTTGAAATGCTCAAATATTTTGCTCGATGATGATTACTTTCCAAAGCTATCCGACTTCGGGTTGGCTAAACTTGGCCCAGTTGGGGACAAGTCTCATGTGTCCACTCGGGTTATGGGAACATACGGATACTGTGCTCCCGAGTATGCAATGACAGGCCAGCTAACACTCAAATCAGACGTTTACAGCTTCGGTGTTGTTCTGTTGGAGATTATAACTGGTCGGAAAGCAATAGACAGTTCAAGATCTACTGGAGAACAGAATCTAGTCGCATGGGCAAGGCCTTTGTTTAAAGACAGGAGGAAATTCTCTCAGATGGCTGATCCAATGCTTCAAGGTCAATACCCTCCGCGAGGGTTATACCAAGCACTCGCTGTAGCAGCGATGTGCGTACAAGAGCAGCCAAATCTTAGACCTCTCATTGCTGACGTCGTCACTGCACTTTCTTACCTCGCCTCCCAAAAGTTTGATCCTCTGGCTCAGCCAGTCCAAGGATCCCTTTTCGCTCCAGGGACTCCACCTAGATCAAAGAGGGTCTGAAAATAATCCCGAGAACCGCAATGCTGTGTAAGTTATGTAGCTTAAACCCATTCCGTGCTGTCTTTCTTGGAGAGGAAAGGTGGATGATTTTCAGACTAAGTGTGAATGTATGGCTTAAGAGCTACTTGTAGATATGTGTAAGAAGAGATAGATTCATATAGAGGCCGGTTTATAATGTTGTTATAGGTGATGTTGTTTAATGTAATGTTTATTGAGCGCTTGCTTTCAAATGTGACAATTTCTCATTATTGTACTGAGGATGTCTGCTTCGATTCCAAAGTTATTGTATAAATATTAAAGTACTATAGTTTTCAAAA


Protein sequences

Name Description Sequence
At.4975 translated coding region predicted by ESTScan from UniGene At.4975

MGWIPCSGKSSGRNKTRRNGDHKLDRKSSDCSVSTSEKSRAKSSLSESKSKGSDHIVAQTFTFSELATATRNFRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYLASQKFDPLAQPVQGSLFAPGTPPRSKRV

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
45-370 Kinase_like
Protein kinase-like domain

LSESKSKGSDHIVAQTFTFSELATATRNFRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYLASQKFDPLAQPVQGSLFAPG

HMMPanther: PTHR24420:SF799
46-363 PTHR24420:SF799

SESKSKGSDHIVAQTFTFSELATATRNFRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYLASQKFDPLAQPVQ

HMMPanther: PTHR24420
46-363 PTHR24420,FAMILY NOT NAMED

SESKSKGSDHIVAQTFTFSELATATRNFRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYLASQKFDPLAQPVQ

Gene3D: G3DSA:3.30.200.20
58-135 G3DSA:3.30.200.20

AQTFTFSELATATRNFRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIG

ProfileScan: PS50011
IPR000719
73-350 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRKECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVVTALSYL

HMMPfam: PF00069
IPR017442
76-344 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ECLIGEGGFGRVYKGYLASTSQTAAIKQLDHNGLQGNREFLVEVLMLSLLHHPNLVNLIGYCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVV

PatternScan: PS00107
IPR017441
79-102 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGRVYKGYLASTSQTAAIK

Gene3D: G3DSA:1.10.510.10
136-344 G3DSA:1.10.510.10

YCADGDQRLLVYEYMPLGSLEDHLHDISPGKQPLDWNTRMKIAAGAAKGLEYLHDKTMPPVIYRDLKCSNILLDDDYFPKLSDFGLAKLGPVGDKSHVSTRVMGTYGYCAPEYAMTGQLTLKSDVYSFGVVLLEIITGRKAIDSSRSTGEQNLVAWARPLFKDRRKFSQMADPMLQGQYPPRGLYQALAVAAMCVQEQPNLRPLIADVV

PatternScan: PS00108
IPR008271
196-208 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDLKCSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox