PRGDB00065889 (At.5038)

From PRG Wiki
Jump to: navigation, search
At.5038
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 9280635 (AF286050)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CBL-interacting protein kinase 2 (CIPK2) mRNA, complete cds

DNA Sequence

GATGGAGAACAAACCAAGTGTATTAACTGAAAGATATGAAGTTGGGAGGTTATTGGGTCAAGGTACTTTTGCTAAAGTGTATTCTGGAAGGAGTAATCATACCAACGAGAGTGTAGCTATCAAGATGATTGACAAGGACAAAGTTATGAGAGTCGGGCTTAGCCAGCAAATCAAGCGAGAGATCTCTGTAATGAGGATCGCTAAACACCCGAATGTCGTTGAGTTATACGAGGTTATGGCTACAAAGTCAAGGATTTACTTTGTTATTGAGTATTGTAAAGGTGGTGAGCTTTTCAACAAGGTTGCAAAAGGAAAACTTAAAGAAGATGTTGCTTGGAAGTATTTTTATCAGCTTATTAGTGCGGTTGATTTTTGTCACAGCCGCGGAGTTTATCACCGCGACATTAAGCCGGAAAATCTTTTGTTGGATGACAATGATAATCTTAAGGTATCTGATTTTGGTTTAAGTGCGCTTGCTGATTGCAAGCGGCAAGATGGTCTTCTACATACAACTTGTGGTACACCTGCTTATGTTGCGCCCGAGGTTATTAACCGAAAAGGATACGAGGGTACGAAAGCGGATATTTGGTCTTGTGGTGTTGTTTTGTTTGTTCTTTTGGCTGGTTATCTCCCTTTCCATGACACTAATCTTATGGAGATGTATAGGAAGATAGGTAAAGCAGACTTCAAGTGTCCCAGCTGGTTTGCTCCTGAGGTAAAGAGACTATTGTGTAAGATGTTGGACCCTAACCATGAGACTAGAATCACTATTGCAAAAATCAAGGAGAGTTCTTGGTTCAGAAAGGGTTTGCATTTGAAGCAAAAAAAGATGGAAAAGATGGAGAAACAACAAGTCAGAGAGGCTACTAATCCCATGGAAGCTGGAGGTTCAGGCCAAAATGAAAACGGAGAAAACCACGAGCCGCCTCGACTTGCTACCTTGAATGCTTTCGATATCATCGCCTTGTCTACGGGGTTTGGTCTGGCAGGACTTTTTGGGGATGTATATGACAAGCGAGAATCTAGGTTCGCGTCGCAAAAACCTGCTTCAGAGATCATTTCTAAGCTAGTAGAGGTTGCCAAGTGCCTGAAGCTGAAGATAAGAAAGCAAGGCGCAGGCTTGTTCAAACTGGAAAGAGTAAAGGAAGGAAAAAACGGAATTTTGACGATGGATGCAGAGATATTCCAAGTGACGCCGACGTTTCACCTGGTGGAAGTGAAGAAATGTAATGGAGATACAATGGAGTATCAGAAGTTAGTGGAGGAGGATCTTAGGCCTGCTTTGGCAGATATTGTTTGGGTTTGGCAAGGCGAGAAGGAGAAAGAGGAGCAGTTACTGCAGGATGAACAAGGAGAGCAAGAACCATCATAGCAAGTTCAGCTACAAGCCTACAACTGCAAGCACATGAATTGTTGCAGGAACATGAAAATGGTAACCCTCTTGCGACTTCAGCTGAAACAGAAGCAAGCATCAAGAAACTCTAACGAAAACAGAGGAAGGAAAACAATAACAATTGCACAAAATGGATTCTTTTTGCATATAGACTACAAAAATTGTAGATAGTTGATTGATTTGTAACAACTACGAGCttttttttttACCTTGCCTCTTGTGAAGTTTTGAACGTATATTGTTTCATGAGTACAGTAATTGAATTTCTTTAAGAGTTTGGTCGATACATaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.5038 translated coding region predicted by ESTScan from UniGene At.5038

XMENKPSVLTERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPMEAGGSGQNENGENHEPPRLATLNAFDIIALSTGFGLAGLFGDVYDKRESRFASQKPASEIISKLVEVAKCLKLKIRKQGAGLFKLERVKEGKNGILTMDAEIFQVTPTFHLVEVKKCNGDTMEYQKLVEEDLRPALADIVWVWQGEKEKEEQLLQDEQGEQEPSXASSATSLQLQAHELLQEHENGNPLATSAETEASIKKL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
2-294 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MENKPSVLTERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPME

HMMPanther: PTHR24343
2-294 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MENKPSVLTERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPME

Gene3D: G3DSA:3.30.200.20
4-109 no description

NKPSVLTERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKE

superfamily: SSF56112
IPR011009
8-298 Protein kinase-like (PK-like)
Protein kinase-like domain

VLTERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPMEAGGS

ProfileScan: PS50011
IPR000719
13-267 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWF

HMMPfam: PF00069
IPR017442
13-267 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWF

HMMSmart: SM00219
IPR020635
13-267 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWF

HMMSmart: SM00220
IPR002290
13-267 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWF

PatternScan: PS00107
IPR017441
19-42 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYSGRSNHTNESVAIK

Gene3D: G3DSA:1.10.510.10
110-304 no description

DVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPMEAGGSGQNENG

PatternScan: PS00108
IPR008271
131-143 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDIKPENLLL

Seg: seg
140-149 seg

NLLLDDNDNL

Seg: seg
274-285 seg

KQKKMEKMEKQQ

ProfileScan: PS50816
IPR018451
310-334 NAF
NAF/FISL domain

PRLATLNAFDIIALSTGFGLAGLFG

HMMPfam: PF03822
IPR004041
313-370 NAF
NAF domain

ATLNAFDIIALSTGFGLAGLFGDVYDKRESRFASQKPASEIISKLVEVAKCLKLKIRK

Seg: seg
437-455 seg

QGEKEKEEQLLQDEQGEQE

Seg: seg
457-477 seg

SXASSATSLQLQAHELLQEHE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox