PRGDB00065902 (At.7702)

From PRG Wiki
Jump to: navigation, search
At.7702
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14009295 (AY030303)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CBL-interacting protein kinase 19 (CIPK19) mRNA, complete cds

DNA Sequence

ATGGCGGATTTGTTAAGAAAAGTGAAATCGATAAAGAAGAAGCAGGATCAGAGCAATCATCAAGCTCTGATCCTTGGCAAATACGAAATGGGTAGGCTTCTTGGCCACGGAACCTTCGCTAAAGTCTATCTCGCACGAAACGCTCAATCTGGAGAAAGCGTAGCTATCAAGGTAATTGACAAAGAGAAAGTTCTCAAATCCGGTTTAATCGCACACATCAAACGCGAGATCTCGATCTTGCGCCGTGTTCGTCATCCTAACATCGTTCAGCTATTCGAAGTCATGGCGACGAAATCTAAGATCTATTTCGTAATGGAATATGTTAAAGGAGGTGAATTGTTCAACAAGGTAGCTAAAGGAAGGTTAAAAGAAGAAATGGCACGTAAATATTTTCAACAGTTGATCTCAGCCGTATCGTTTTGTCACTTCCGTGGTGTTTATCATCGAGATTTGAAACCGGAGAATCTTCTTTTAGACGAAAATGGAAACCTAAAAGTCTCTGATTTTGGTCTTAGTGCTGTTTCTGATCAGATTCGACAAGATGGGTTATTTCATACTTTTTGTGGGACCCCTGCTTACGTGGCACCGGAGGTTCTTGCTCGGAAAGGCTACGATGGAGCTAAAGTCGATATTTGGTCTTGTGGAGTGATCTTGTTTGTGTTAATGGCAGGGTTTCTTCCTTTTCATGATCGGAATGTTATGGCTATGTATAAGAAGATTTACAGAGGAGATTTTAGGTGTCCGAGATGGTTTCCGGTTGAGATTAACCGGTTATTGATTCGAATGTTGGAGACTAAACCGGAGAGACGGTTTACAATGCCGGATATTATGGAGACTAGTTGGTTCAAGAAAGGTTTTAAGCATATTAAGTTTTATGTTGAAGATGATCATCAGCTTTGTAACGTTGCTGATGATGATGAGATCGAATCGATTGAATCGGTTTCGGGGAGGTCTTCTACGGTTTCTGAACCGGAAGACTTCGAGTCTTTTGATGGGAGGAGAAGAGGTGGTTCGATGCCTAGACCGGCAAGTTTGAATGCTTTCGATCTCATTTCGTTTTCGCCAGGTTTTGATCTTTCGGGTTTGTTTGAGGATGATGGTGAAGGATCTAGGTTTGTGTCTGGTGCTCCTGTTGGTCAGATCATTTCTAAGTTGGAGGAAATCGCGAGGATTGTGAGTTTTACTGTGCGAAAGAAGGATTGTAAAGTGAGTCTTGAAGGTTCAAGAGAAGGAAGTATGAAAGGTCCATTGTCAATTGCTGCTGAGATATTTGAACTGACACCAGCTTTGGTTGTTGTTGAAGTGAAGAAGAAAGGAGGTGATAAAATGGAGTATGATGAGTTTTGTAATAAGGAGTTGAAACCTAAGTTGCAGAATTTGTCTTCCGAAAATGGCCAACGGGTTTCTGGTTCGCGTTCTTTGCCATCGTTTTTACTTTCTGATACTGATTAG


Protein sequences

Name Description Sequence
At.7702 translated coding region predicted by ESTScan from UniGene At.7702

MADLLRKVKSIKKKQDQSNHQALILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKGFKHIKFYVEDDHQLCNVADDDEIESIESVSGRSSTVSEPEDFESFDGRRRGGSMPRPASLNAFDLISFSPGFDLSGLFEDDGEGSRFVSGAPVGQIISKLEEIARIVSFTVRKKDCKVSLEGSREGSMKGPLSIAAEIFELTPALVVVEVKKKGGDKMEYDEFCNKELKPKLQNLSSENGQRVSGSRSLPSFLLSDTD

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
14-313 Kinase_like
Protein kinase-like domain

KQDQSNHQALILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKGFKHIKFYVEDDHQLCNVADDDEIESIES

Gene3D: G3DSA:3.30.200.20
23-124 G3DSA:3.30.200.20

LILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKE

HMMPanther: PTHR24343:SF45
23-335 PTHR24343:SF45,SERINE/THREONINE-PROTEIN KINASE PTK1

LILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKGFKHIKFYVEDDHQLCNVADDDEIESIESVSGRSSTVSEPEDFESFDGRRR

HMMPanther: PTHR24343
23-335 PTHR24343,SERINE/THREONINE KINASE

LILGKYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKGFKHIKFYVEDDHQLCNVADDDEIESIESVSGRSSTVSEPEDFESFDGRRR

HMMPfam: PF00069
IPR017442
28-282 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWF

ProfileScan: PS50011
IPR000719
28-282 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWF

HMMSmart: SM00220
IPR002290
28-282 S_TKc
Serine/threonine-protein kinase domain

YEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILRRVRHPNIVQLFEVMATKSKIYFVMEYVKGGELFNKVAKGRLKEEMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWF

PatternScan: PS00107
IPR017441
34-57 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGHGTFAKVYLARNAQSGESVAIK

Gene3D: G3DSA:1.10.510.10
125-312 G3DSA:1.10.510.10

EMARKYFQQLISAVSFCHFRGVYHRDLKPENLLLDENGNLKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLARKGYDGAKVDIWSCGVILFVLMAGFLPFHDRNVMAMYKKIYRGDFRCPRWFPVEINRLLIRMLETKPERRFTMPDIMETSWFKKGFKHIKFYVEDDHQLCNVADDDEIESIE

PatternScan: PS00108
IPR008271
146-158 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
340-364 NAF
NAF/FISL domain

PRPASLNAFDLISFSPGFDLSGLFE

HMMPfam: PF03822
IPR004041
341-398 NAF
NAF domain

RPASLNAFDLISFSPGFDLSGLFEDDGEGSRFVSGAPVGQIISKLEEIARIVSFTVRK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox