PRGDB00065906 (At.7930)

From PRG Wiki
Jump to: navigation, search
At.7930
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186526710 (NM_122932)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SOS2 (SALT OVERLY SENSITIVE 2); kinase

DNA Sequence

AATTCAGGTCGTATACGGGTACAGTCAAATAACCCGACCCGAAATGCTCAACGGATCTGCACGGACGTTCGCATCGACGATTCACGGCTTTCGCGAATCGCATCACGAGCCTTCCTTCTCTCCTACGCCTCTTTCATCAACCCTTCTCTGCGAATCCAATTCTGATAAAAGTTTGTAAAGAATGACAAAGAAAATGAGAAGAGTGGGCAAGTACGAGGTTGGTCGCACAATAGGTGAAGGAACCTTTGCTAAGGTTAAGTTTGCGAGGAACACAGACACTGGTGATAATGTAGCCATCAAAATTATGGCTAAGAGTACAATACTTAAGAACAGAATGGTTGATCAGATAAAAAGAGAGATATCTATAATGAAGATTGTTCGTCACCCGAACATAGTGAGGTTGTATGAGGTGTTGGCGAGTCCTTCGAAAATATATATAGTTTTGGAGTTTGTGACAGGAGGAGAGCTCTTTGATAGAATTGTTCATAAAGGGAGGCTTGAAGAAAGTGAGTCTCGGAAATACTTTCAACAGCTTGTAGATGCTGTTGCTCATTGTCACTGCAAGGGTGTTTACCACCGTGACCTAAAGCCAGAAAATCTTTTACTCGATACAAATGGAAATCTGAAGGTTTCGGATTTCGGACTCAGTGCATTGCCTCAGGAAGGAGTAGAACTTCTGCGTACCACATGTGGAACTCCGAACTATGTAGCTCCAGAGGTACTTAGTGGACAGGGTTACGATGGTTCAGCAGCTGATATTTGGTCTTGCGGGGTTATTCTTTTCGTTATATTGGCTGGATATTTACCTTTTTCCGAGACGGATCTTCCAGGGTTGTACAGAAAAATAAATGCAGCAGAGTTTTCTTGTCCACCGTGGTTTTCCGCAGAAGTGAAGTTTTTAATACATAGGATACTTGACCCCAATCCCAAAACACGTATTCAAATTCAAGGAATCAAGAAAGATCCTTGGTTCAGATTAAATTATGTGCCTATACGAGCAAGGGAAGAAGAAGAAGTGAATTTGGATGATATTCGTGCAGTTTTTGATGGAATTGAGGGCAGTTATGTAGCGGAGAATGTAGAGAGAAATGATGAAGGGCCCCTGATGATGAATGCCTTTGAGATGATTACCTTATCACAAGGCTTAAATTTATCTGCACTATTTGACAGGCGACAGGATTTTGTTAAAAGGCAAACCCGTTTTGTTTCTCGAAGGGAACCTAGTGAGATAATTGCTAACATTGAGGCTGTAGCGAACTCAATGGGTTTTAAGTCTCATACACGAAACTTCAAGACAAGGCTCGAGGGATTATCTTCGATCAAGGCCGGACAGTTAGCTGTTGTGATAGAGATTTACGAGGTGGCACCATCGCTTTTCATGGTAGACGTAAGAAAGGCTGCTGGTGAAACTCTTGAATATCACAAGTTCTACAAGAAGCTATGTTCGAAACTGGAAAACATAATATGGAGGGCAACAGAAGGAATACCAAAGTCAGAGATTCTCAGAACAATCACGTTTTGATCCCAACTTAAATCCAATAAAAATGTACACTTGTGTAATAAATGACCTAATTATTCTTCAGGGAGATTGGAAGATTTGCTTCTTGAGCTAGTATTCTAATTTGATTGTGTCTTGTAGTTTGCTTTGGCCATTGGTTTGGATCCCTCTGTTCTCTGTGTATGGCAATACTTCTCAAAACTTGTCCTGCGAAGACATGTACTAACAAAACACATCCAATATGAGTTTGCTTACTAGA


Protein sequences

Name Description Sequence
At.7930 translated coding region predicted by ESTScan from UniGene At.7930

XIQVVYGYSQITRPEMLNGSARTFASTIHGFRESHHEPSFSPTPLSSTLLCESNSDKSLXRMTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWRATEGIPKSEILRTITF

Domains

Domain Start-End Description Sequence

Seg: seg
38-50 seg

PSFSPTPLSSTLL

Gene3D: G3DSA:3.30.200.20
55-168 no description

SDKSLXRMTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLE

superfamily: SSF56112
IPR011009
58-326 Protein kinase-like (PK-like)
Protein kinase-like domain

SLXRMTKKMRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFR

HMMPanther: PTHR24344:SF45
66-505 SUBFAMILY NOT NAMED

MRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWRATEGIPKSEILRTI

HMMPanther: PTHR24344
66-505 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE CDS1

MRRVGKYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIRAREEEEVNLDDIRAVFDGIEGSYVAENVERNDEGPLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKSHTRNFKTRLEGLSSIKAGQLAVVIEIYEVAPSLFMVDVRKAAGETLEYHKFYKKLCSKLENIIWRATEGIPKSEILRTI

HMMPfam: PF00069
IPR017442
72-325 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWF

ProfileScan: PS50011
IPR000719
72-325 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWF

HMMSmart: SM00220
IPR002290
72-325 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWF

HMMSmart: SM00219
IPR020635
72-323 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMKIVRHPNIVRLYEVLASPSKIYIVLEFVTGGELFDRIVHKGRLEESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDP

PatternScan: PS00107
IPR017441
78-110 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGTFAKVKFARNTDTGDNVAIKIMAKSTILK

Gene3D: G3DSA:1.10.510.10
169-333 no description

ESESRKYFQQLVDAVAHCHCKGVYHRDLKPENLLLDTNGNLKVSDFGLSALPQEGVELLRTTCGTPNYVAPEVLSGQGYDGSAADIWSCGVILFVILAGYLPFSETDLPGLYRKINAAEFSCPPWFSAEVKFLIHRILDPNPKTRIQIQGIKKDPWFRLNYVPIR

PatternScan: PS00108
IPR008271
191-203 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
366-390 NAF
NAF/FISL domain

EGPLMMNAFEMITLSQGLNLSALFD

HMMPfam: PF03822
IPR004041
368-426 NAF
NAF domain

PLMMNAFEMITLSQGLNLSALFDRRQDFVKRQTRFVSRREPSEIIANIEAVANSMGFKS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox