PRGDB00065909 (At.8519)

From PRG Wiki
Jump to: navigation, search
At.8519
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42458657 (BX830235)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Full-length cDNA Complete sequence from clone GSLTFB68ZB04 of Flowers and buds of strain col-0 of Arabidopsis thaliana (thale cress)

DNA Sequence

AATACATCAAATGAGAGGTTTGGTTCATGTTTTATTAATCAATCCGAATAACATTACATATTTGTCTATATTATTGACTCAAATATATTTTTTCGTAATCCTAGAGATAAGCTTGGTTTACTTGCAAATTTCAAGAGGAGCACCACACAAACACTTGTTGTAAAAATAGGAATAAGAATCAAATGTCTGAAGTTTCCCTCCAGTTGGGATGTGTCCACACAGTTTGTTGTAGCTAACATTGAAGAACTGAAGAGGAGCTTCAGTCCGCTGCACCGGAATATTCCCAGTTATCCCATTGTGGTTCAAGTCCAAGATACCAAGTGTTTTAGGGATATCAACCTTTGAGATATCGAACTGGAACATGTTTCTTGATAAGTCAATAGACCAGGTTGTTTTGTTGGAACCAAACAACATCGAAGCATCACCTTGGAGCTTGTTGCGGGATAAATCGATCCGGTTAAAGTCGATGTTGCCTAATGATTTGGGTATTGGACCGGAGAGCTGGTTATGTTAAAAGCGAAGGTCAGGGACTGTTCCTGGAAACGACCCAAATGACTCTTGTATGGAACCTACAACATAAAGATCGTTGTTTAGACAAGACACTTAATGATGTAATAAAGGAAAAGATCGTTCTTTACCTGTAAGTTTGTTCCTGCTAAGTTCAAGAGCCAAGATTTTAGGTAACGTAGAGAGAGAACTTGGAATGGAACCAGAAAGATCATTGAAGGAAAGTTCTAAGAACTCGAGATTCTTGAGCTGACTTATAAAGTCAGGAATTGGACCTTTAAGATTCGTCCAGCTGAGCCTGAGAATTCGGAGGTTCTTGAGTTTGGCGATGGTGGGTTGGATTGTACCGGTGAGGTTAGAGAGTTTGCGGAAAACAAGGTTCTCAAGATACGGCAAGTAACCAACTTCAGCCGGGATCTGACCGGAGTTCTGGCCGGAGAATATGGTTAAGGCGGTAACACGGTGGTTAAGGGTGGCGTCGCCGAACTCAAGGCAGTACCAGGAGCAACAGTCGGTTTGAGGGTCCCATGAAGCGAGGTGATAAGGGTTGTTTAGAGATTTCTTGATCTTGAGGAGGGTGTTTTTGTCATTTTGGTTACAGAGATCTTTAGACAAACAGGTCGTGAGGAATGTGAACAAGAACAAGAGACAAAATGTCGCTGTCTTATCCATGGTGTTGGTTTTGAATTTTGATGGAAAGTGTTAGTGATACATATACATACTATATAGTGAGTGATATAGACTTAAAGAGACGGATTCGATTTGATCTCTGTTTCCACATGGACCGTAATAATAGTCAATACATATCATATAGTCAAGATGTCGGCGTTGAATATGTTTGGGTAATGTAATTAC


Protein sequences

Name Description Sequence
At.8519 translated coding region predicted by ESTScan from UniGene At.8519

MDKTATFCLLFLFTFLTTCLSKDLCNQNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWYCLEFGDATLNHRVTALTIFSGQNSGQIPAEVGYLPYLENLVFRKLSNLTGTIQPTIAKLKNLRILRLSWTNLKGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGKERSFPLLHHXVSCLNNDLYVVGSIQESFGSFPGTVPDLRFXHNQLSGPIPKSLGNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDISKVDIPKTLGILDLNHNGITGNIPVQRTEAPLQFFNVSYNKLCGHIPTGGKLQTFDSYSYFYNKCLCGAPLEICK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-346 FAMILY NOT NAMED,FAMILY NOT NAMED

MDKTATFCLLFLFTFLTTCLSKDLCNQNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWYCLEFGDATLNHRVTALTIFSGQNSGQIPAEVGYLPYLENLVFRKLSNLTGTIQPTIAKLKNLRILRLSWTNLKGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGKERSFPLLHHXVSCLNNDLYVVGSIQESFGSFPGTVPDLRFXHNQLSGPIPKSLGNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDISKVDIPKTLGILDLNHNGITGNIPVQRTEAPLQFFNVSYNKLCGHIPTGGKLQTFDSYSYFYNKCLCG

HMMPanther: PTHR24420:SF918
1-346 PGIP1 (POLYGALACTURONASE INHIBITING PROTEIN 1); PROTEIN BINDING

MDKTATFCLLFLFTFLTTCLSKDLCNQNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWYCLEFGDATLNHRVTALTIFSGQNSGQIPAEVGYLPYLENLVFRKLSNLTGTIQPTIAKLKNLRILRLSWTNLKGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGKERSFPLLHHXVSCLNNDLYVVGSIQESFGSFPGTVPDLRFXHNQLSGPIPKSLGNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDISKVDIPKTLGILDLNHNGITGNIPVQRTEAPLQFFNVSYNKLCGHIPTGGKLQTFDSYSYFYNKCLCG

Seg: seg
6-20 seg

TFCLLFLFTFLTTCL

superfamily: SSF52058
23-353 L domain-like,LRR

DLCNQNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWYCLEFGDATLNHRVTALTIFSGQNSGQIPAEVGYLPYLENLVFRKLSNLTGTIQPTIAKLKNLRILRLSWTNLKGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGKERSFPLLHHXVSCLNNDLYVVGSIQESFGSFPGTVPDLRFXHNQLSGPIPKSLGNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDISKVDIPKTLGILDLNHNGITGNIPVQRTEAPLQFFNVSYNKLCGHIPTGGKLQTFDSYSYFYNKCLCGAPLEICK

Gene3D: G3DSA:3.80.10.10
25-350 no description

CNQNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWYCLEFGDATLNHRVTALTIFSGQNSGQIPAEVGYLPYLENLVFRKLSNLTGTIQPTIAKLKNLRILRLSWTNLKGPIPDFISQLKNLEFLELSFNDLSGSIPSSLSTLPKILALELSRNKLTGKERSFPLLHHXVSCLNNDLYVVGSIQESFGSFPGTVPDLRFXHNQLSGPIPKSLGNIDFNRIDLSRNKLQGDASMLFGSNKTTWSIDLSRNMFQFDISKVDIPKTLGILDLNHNGITGNIPVQRTEAPLQFFNVSYNKLCGHIPTGGKLQTFDSYSYFYNKCLCGAPLE

HMMPfam: PF08263
IPR013210
27-59 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

QNDKNTLLKIKKSLNNPYHLASWDPQTDCCSWY

HMMPfam: PF00560
IPR001611
144-166 LRR_1
Leucine-rich repeat

NLEFLELSFNDLSGSIPSSLSTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox