PRGDB00065910 (At.8676)

From PRG Wiki
Jump to: navigation, search
At.8676
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30693271 (NM_123217)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT5G38560) mRNA, complete cds

DNA Sequence

AAAACGAAACTCAAGTCAATGAATAAAAAGACGAAACAATGCTATGATAAGAAAAGAAACAACACTCGAAAAAGTTCTTCTTTTTCTTCCGCACATGTCTGACTCTCTCATAAGCGTAAATCGCTCTGTCAAATATCTCTGACCAGAGAGACAGAGTTGCCTCCACGTTTCTTCAGACAAGACTCACGCTCTTCCCTTTCACCACATTCCCTTCTCCATTTCTCAATCTCACTTACCTTCTCGATTCTTGCTCCAATTTCGAATCTTCCGAGTGAAAAAAGCTTCAAAGTTTGGAACTTTCTAGTGTTTATTAATCTGGGTCTGCTCTGAGTTTCGTGTGTAGCTGCATATGAGCTTAAAGCTCGAGTTTTTCCATCTGGGTTTGGAATTCTAGGGCTAGTGATTGGAGATTTTGGGAATTTAGGTTGATTTTAGTAGGTTTGACTTCAGGTTGCGTAATTTAGGTTGATTTTGATCCGATTTGTGGAATTAGGGTTTGTTTGTTCACAAAGCTTCAATTTTTGGAGTTTAAATGGATCGATAACGACTGTGTTAGAAGAAAGTTTGCTGCTTCAGATTCGTATTCGATATAGAAATGAGTTTGGTTCCTCCTTTACCGATTTTATCACCACCGTCGTCAAATTCTTCAACAACTGCACCTCCTCCGTTACAGACTCAGCCCACCACTCCATCTGCTCCACCTCCGGTTACACCACCTCCTTCTCCGCCGCAATCTCCGCCGCCGGTTGTATCATCATCACCACCACCACCGGTTGTTTCGTCACCTCCACCGTCTTCTTCTCCACCACCGTCACCTCCTGTCATCACTTCAcctcctcccaccgttgcttcttcccctccacctcctgtggtgattgcttcccctcctccctcAACTCCGGCGACAACACCACCAGCTCCTCCGCAAACTGTCTCACCTCCACCGCCTCCTGATGCTTCTCCATCACCTCCCGCACCAACAACAACAAATCCTCCTCCTAAACCTTCTCCTTCACCGCCGGGAGAAACACCTTCACCACCGGGAGAAACACCTTCACCgcctaaaccttctccgtcaactccaactccaacaacaaccacatctcctcctcctcctccagctacctctgcttctcctccGTCTTCAAATCCTACTGATCCTTCTACGTTAGCTCCTCCTCCAACTCCATTACCTGTTGTTCCCAGAGAGAAACCAATTGCTAAACCAACTGGACCAGCTTCAAACAATGGAAACAACACTTTGCCGTCTAGTTCACCAGGTAAAAGCGAAGTTGGTACTGGAGGTATTGTAGCTATCGGAGTGATTGTGGGATTGGTTTTTCTTAGCCTTTTTGTGATGGGTGTGTGGTTCACTCGGAAACGAAAGCGAAAGGACCCTGGAACCTTTGTTGGATACACAATGCCTCCTTCCGCTTATTCATCTCCTCAAGGCTCAGATGTAGTGCTCTTCAACTCGCGTTCTTCAGCTCCTCCTAAAATGAGAAGCCATTCTGGTAGCGATTACATGTATGCGTCATCTGATTCAGGCATGGTTAGCAACCAAAGATCATGGTTTTCATATGATGAGTTATCTCAAGTTACCAGTGGGTTCTCCGAGAAGAATCTTCTCGGTGAAGGAGGGTTTGGCTGTGTATACAAAGGCGTTCTTTCTGACGGAAGGGAAGTGGCAGTTAAACAGTTAAAGATTGGTGGAAGCCAAGGGGAGAGAGAGTTCAAAGCAGAAGTTGAAATCATTTCTCGGGTTCATCACCGCCATTTGGTTACACTAGTTGGTTATTGCATCTCAGAGCAACATAGGTTGCTTGTATATGATTATGTACCTAACAACACTCTCCATTATCATCTCCATGCTCCAGGAAGACCAGTTATGACTTGGGAAACTCGGGTAAGGGTCGCTGCTGGTGCAGCTCGTGGAATCGCCTACTTACATGAAGACTGTCATCCCCGCATTATTCACCGTGACATAAAATCTTCCAACATACTTCTTGATAACAGCTTTGAAGCCTTGGTTGCGGATTTTGGACTTGCAAAAATTGCACAAGAACTGGATTTAAACACACACGTCTCAACGCGCGTAATGGGAACCTTTGGGTACATGGCTCCTGAATATGCAACAAGTGGAAAGCTGTCTGAAAAAGCAGATGTTTATTCGTATGGGGTAATACTGTTGGAGCTTATAACTGGCCGTAAACCCGTAGATACGTCTCAACCACTTGGTGATGAGAGCCTTGTTGAATGGGCAAGACCCTTGCTGGGTCAAGCAATCGAGAACGAAGAATTCGACGAGCTAGTAGATCCGAGGCTAGGGAAAAACTTCATCCCAGGAGAGATGTTCAGAATGGTAGAAGCTGCGGCTGCATGTGTCCGCCACTCAGCTGCAAAAAGACCAAAGATGAGTCAAGTGGTGAGAGCTTTGGACACACTTGAAGAAGCAACGGACATAACCAACGGAATGAGACCAGGACAGAGCCAAGTGTTTGACTCGAGACAACAATCTGCTCAGATAAGGATGTTTCAAAGAATGGCTTTTGGGAGTCAAGATTATAGTTCTGACTTCTTTGATCGCTCACAGTCACATAGTAGCTGGGGCAGTCGTGACCAGTCCAGATTTGTACCTTAGTAGTTTTTATTGCCTTTGCTTCTTTCTTCTTTCCCTTTAAACATGTCCTCGATCTTGTATATTCTTTTGCATGATATAATGTATTTTTGAAATATACATACATACACACATAAAATTTGGTAGTCTTTTGAAGAAAAAGAATAACAGATGTATTTGA


Protein sequences

Name Description Sequence
At.8676 translated coding region predicted by ESTScan from UniGene At.8676

MSLVPPLPILSPPSSNSSTTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGPASNNGNNTLPSSSPGKSEVGTGGIVAIGVIVGLVFLSLFVMGVWFTRKRKRKDPGTFVGYTMPPSAYSSPQGSDVVLFNSRSSAPPKMRSHSGSDYMYASSDSGMVSNQRSWFSYDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATDITNGMRPGQSQVFDSRQQSAQIRMFQRMAFGSQDYSSDFFDRSQSHSSWGSRDQSRFVP

Domains

Domain Start-End Description Sequence

FPrintScan: PR01218
IPR003882
19-42 PSTLEXTENSIN
Pistil-specific extensin-like protein

TTAPPPLQTQPTTPSAPPPVTPPP

FPrintScan: PR01218
IPR003882
53-71 PSTLEXTENSIN
Pistil-specific extensin-like protein

SSSPPPPVVSSPPPSSSPP

HMMPanther: PTHR24420:SF644
64-678 PTHR24420:SF644

PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGPASNNGNNTLPSSSPGKSEVGTGGIVAIGVIVGLVFLSLFVMGVWFTRKRKRKDPGTFVGYTMPPSAYSSPQGSDVVLFNSRSSAPPKMRSHSGSDYMYASSDSGMVSNQRSWFSYDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATDITNGMRPGQSQVFDSRQQSAQIRMFQRMAFGSQDYSSDFFDRSQSHSSWGSRDQSR

HMMPanther: PTHR24420
64-678 PTHR24420,FAMILY NOT NAMED

PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLAPPPTPLPVVPREKPIAKPTGPASNNGNNTLPSSSPGKSEVGTGGIVAIGVIVGLVFLSLFVMGVWFTRKRKRKDPGTFVGYTMPPSAYSSPQGSDVVLFNSRSSAPPKMRSHSGSDYMYASSDSGMVSNQRSWFSYDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATDITNGMRPGQSQVFDSRQQSAQIRMFQRMAFGSQDYSSDFFDRSQSHSSWGSRDQSR

superfamily: SSF56112
IPR011009
309-622 Kinase_like
Protein kinase-like domain

DYMYASSDSGMVSNQRSWFSYDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTLEEATD

Gene3D: G3DSA:3.30.200.20
321-415 G3DSA:3.30.200.20

SNQRSWFSYDELSQVTSGFSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYV

ProfileScan: PS50011
IPR000719
339-617 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALDTL

HMMPfam: PF00069
IPR017442
341-610 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EKNLLGEGGFGCVYKGVLSDGREVAVKQLKIGGSQGEREFKAEVEIISRVHHRHLVTLVGYCISEQHRLLVYDYVPNNTLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQV

PatternScan: PS00107
IPR017441
345-367 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVYKGVLSDGREVAVK

Gene3D: G3DSA:1.10.510.10
419-615 G3DSA:1.10.510.10

TLHYHLHAPGRPVMTWETRVRVAAGAARGIAYLHEDCHPRIIHRDIKSSNILLDNSFEALVADFGLAKIAQELDLNTHVSTRVMGTFGYMAPEYATSGKLSEKADVYSYGVILLELITGRKPVDTSQPLGDESLVEWARPLLGQAIENEEFDELVDPRLGKNFIPGEMFRMVEAAAACVRHSAAKRPKMSQVVRALD

PatternScan: PS00108
IPR008271
459-471 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox