PRGDB00065911 (At.8850)

From PRG Wiki
Jump to: navigation, search
At.8850
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358106 (NM_121665)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana LRR1; ATP binding

DNA Sequence

ATAGCCGTCGAGACAGATAGAGAGAGCTGAAATTTCTGTGAGAAGATTTTCTTCCGACATTTTCTCTTTCCAAACACTGTTCTACACGTAGTCGGAAATCTCGGAAAAACCAATCTCCGAGTCagagagagagagagagGCGTTCACTGTTGTAAAGGATTAAGCTTTGGGTAAGAAGAAGATGAAGAACAAGACCAATTTAGGTCTCTCAGTCTTCTTCTTCTTTATATGTCTCGTTTCCGTGACATCAGATCTAGAAGCTGATCGACGAGCTCTAATCGCACTTCGTGACGGTGTTCATGGGCGTCCATTGCTGTGGAATCTAACAGCACCACCGTGTACTTGGGGAGGAGTCCAATGTGAGTCGGGTCGTGTCACAGCACTCCGATTACCCGGTGTGGGTTTATCGGGTCCATTACCAATCGCCATCGGAAACCTTACAAAGCTCGAAACTTTATCATTCCGATTCAATGCTCTTAACGGTCCTCTCCCGCCGGATTTCGCAAACCTAACTCTTCTCCGTTACTTGTATCTTCAAGGAAACGCATTTTCCGGCGAGATTCCTTCGTTTCTCTTCACTCTACCAAACATTATTCGGATCAATCTCGCCCAGAATAATTTCTTGGGTCGGATCCCGGATAATGTCAATTCTGCAACCCGGTTAGCTACTCTTTACTTGCAGGATAATCAACTCACCGGTCCAATCCCGGAGATTAAGATTAAGCTTCAACAGTTTAATGTCTCATCCAATCAGTTAAACGGGTCGATTCCGGATCCGTTGTCGGGTATGCCCAAAACCGCCTTTTTAGGCAATTTGCTCTGTGGGAAGCCGTTAGATGCTTGCCCTGTCAATGGCACTGGAAACGGTACTGTGACGCCTGGAGGAAAAGGGAAAAGCGACAAGTTATCTGCCGGAGCTATTGTCGGAATAGTGATCGGCTGTTTCGTCTTGCTTCTCGTGCTTTTCTTGATCGTGTTCTGTCTCTGTAGAAAGAAGAAGAAAGAGCAAGTCGTCCAATCGAGAAGCATCGAAGCAGCTCCTGTTCCGACCTCATCAGCAGCCGTGGCTAAGGAATCGAATGGTCCTCCTGCGGTGGTGGCTAATGGTGCATCTGAAAATGGTGTATCAAAGAACCCTGCTGCAGTGAGTAAAGATCTGACATTTTTCGTGAAATCTTTCGGCGAGTTTGATCTTGATGGATTGCTGAAAGCTTCTGCGGAAGTACTTGGTAAAGGAACGTTCGGATCTTCGTACAAGGCCAGTTTCGATCACGGATTAGTGGTGGCTGTGAAACGATTGAGAGATGTCGTGGTTCCTGAGAAAGAGTTCAGAGAGAAATTGCAGGTTCTTGGATCCATAAGCCATGCCAATCTTGTGACATTGATTGCATATTACTTCAGCCGCGACGAAAAGCTCGTTGTTTTCGAATACATGTCTAGAGGAAGCTTGTCTGCGCTGTTACACGGGAACAAAGGAAGTGGCAGAAGTCCATTGAATTGGGAAACGAGAGCCAATATAGCATTAGGAGCCGCAAGAGCAATTAGCTACCTCCATTCGCGTGACGCGACAACATCTCATGGCAACATTAAATCATCTAACATTCTATTGTCAGAATCCTTTGAAGCTAAGGTCTCTGACTACTGTCTTGCACCTATGATCAGCCCTACTTCTACACCTAACCGCATTGATGGTTACCGAGCTCCTGAAGTAACCGATGCTCGTAAAATCTCCCAAAAGGCTGATGTTTACAGCTTCGGTGTTCTCATTCTTGAATTACTCACAGGGAAATCTCCAACGCATCAGCAGTTACACGAAGAAGGAGTAGATTTACCGAGATGGGTTTCATCGATCACTGAACAACAATCACCATCAGATGTGTTTGATCCAGAGCTCACAAGGTATCAATCGGACAGCAATGAGAACATGATCAGGCTTTTAAACATCGGTATAAGTTGTACGACTCAGTATCCAGATAGTCGTCCTACAATGCCTGAAGTCACAAGACTCATCGAGGAGGTTTCTCGTTCACCTGCTTCACCAGGTCCTTTGTCCGATTGATTGTATTTTTCTTTTTCAATATATGGGGTCTAAATTGATCATTTCAAAATTGTTTGGTCTAAATTTGAATTTCTTTATATAGTTTGGTCTTTAAGTCAGTTGAGAGATCTACGTTGAAGtttttttttttttttttgtgtttcttaatttttttagtgaaattttttATATACAAATTGATTGAGTGTGAAACAAATTATATCTCTCCTTTTC


Protein sequences

Name Description Sequence
At.8850 translated coding region predicted by ESTScan from UniGene At.8850

MKNKTNLGLSVFFFFICLVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQCESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKIKLQQFNVSSNQLNGSIPDPLSGMPKTAFLGNLLCGKPLDACPVNGTGNGTVTPGGKGKSDKLSAGAIVGIVIGCFVLLLVLFLIVFCLCRKKKKEQVVQSRSIEAAPVPTSSAAVAKESNGPPAVVANGASENGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVSRSPASPGPLSD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF544
1-622 LEUCINE-RICH REPEAT TRANSMEMBRANE PROTEIN KINASE, PUTATIVE

MKNKTNLGLSVFFFFICLVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQCESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKIKLQQFNVSSNQLNGSIPDPLSGMPKTAFLGNLLCGKPLDACPVNGTGNGTVTPGGKGKSDKLSAGAIVGIVIGCFVLLLVLFLIVFCLCRKKKKEQVVQSRSIEAAPVPTSSAAVAKESNGPPAVVANGASENGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVSRSPASPGP

HMMPanther: PTHR24420
1-622 FAMILY NOT NAMED,FAMILY NOT NAMED

MKNKTNLGLSVFFFFICLVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQCESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKIKLQQFNVSSNQLNGSIPDPLSGMPKTAFLGNLLCGKPLDACPVNGTGNGTVTPGGKGKSDKLSAGAIVGIVIGCFVLLLVLFLIVFCLCRKKKKEQVVQSRSIEAAPVPTSSAAVAKESNGPPAVVANGASENGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVSRSPASPGP

superfamily: SSF52058
18-209 L domain-like,LRR

LVSVTSDLEADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQCESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKIKLQQFNVSSNQLNGSIPDPLSGMPKTAFL

HMMPfam: PF08263
IPR013210
26-60 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EADRRALIALRDGVHGRPLLWNLTAPPCTWGGVQC

Gene3D: G3DSA:3.80.10.10
43-208 no description

PLLWNLTAPPCTWGGVQCESGRVTALRLPGVGLSGPLPIAIGNLTKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFSGEIPSFLFTLPNIIRINLAQNNFLGRIPDNVNSATRLATLYLQDNQLTGPIPEIKIKLQQFNVSSNQLNGSIPDPLSGMPKTAF

HMMPfam: PF12799
87-124 LRR_4,Leucine Rich repeats (2 copies)

TKLETLSFRFNALNGPLPPDFANLTLLRYLYLQGNAFS

Seg: seg
222-238 seg

PVNGTGNGTVTPGGKGK

Seg: seg
247-269 seg

IVGIVIGCFVLLLVLFLIVFCLC

Seg: seg
285-296 seg

AAPVPTSSAAVA

superfamily: SSF56112
IPR011009
313-624 Protein kinase-like (PK-like)
Protein kinase-like domain

NGVSKNPAAVSKDLTFFVKSFGEFDLDGLLKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEVSRSPASPGPLS

HMMSmart: SM00219
IPR020635
342-610 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LKASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLI

ProfileScan: PS50011
IPR000719
343-613 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLIEEV

HMMSmart: SM00220
IPR002290
343-610 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KASAEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVTRLI

Gene3D: G3DSA:3.30.200.20
346-403 no description

AEVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIA

HMMPfam: PF00069
IPR017442
347-607 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGTFGSSYKASFDHGLVVAVKRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEVT

Seg: seg
366-378 seg

LVVAVKRLRDVVV

Gene3D: G3DSA:1.10.510.10
404-606 no description

YYFSRDEKLVVFEYMSRGSLSALLHGNKGSGRSPLNWETRANIALGAARAISYLHSRDATTSHGNIKSSNILLSESFEAKVSDYCLAPMISPTSTPNRIDGYRAPEVTDARKISQKADVYSFGVLILELLTGKSPTHQQLHEEGVDLPRWVSSITEQQSPSDVFDPELTRYQSDSNENMIRLLNIGISCTTQYPDSRPTMPEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox