PRGDB00065915 (At.9578)

From PRG Wiki
Jump to: navigation, search
At.9578
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21703140 (AY124002)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT5g07070

DNA Sequence

GTGGACCGCCAATGACGTTTAACTTCGTTTTCatctcttcttcttcttcttcttccgtcttctCCTCCATTTTTGTTGGTAAACCCAGAAAGAAATAAGGAAGAGAAGGGGCCTTTAGGGGCGGATAGAGAGATCTACACGTCTTTCTACTAGATCTCGGATTCATTCCCAGAATCCTCTTTCCTCACCGGCTCAATTCTACCAAGTTTCTAAGAGGTTTATTCATATTCGGCATAGAAACTCAGAAATGGTGGAGGATGTGTCCTCCTATCACTAGGGGATTAGCTGCACGAGCTCATGAGGTTATGACTCATGAGCTACCTCCAACTCTGAGCTATCTCTGGATCAAGTAGtttttttttttttttGGAGCCTGTTATAAGTTTGTAGATTAGATGGAAAATAAGCCAAGTGTTTTGACTGATAAATATGATGTTGGGAGGTTATTGGGTCAAGGTACTTTTGCCAAGGTGTATTATGGAAGGAGTATTCTTACTAACCAGAGTGTTGCTATCAAGATGATCGATAAGGAAAAGGTTATGAAAGTTGGGCTTATCGAACAGATCAAGAGAGAGATCTCTGTTATGAGGATTGCTAGACACCCTAACGTTGTGGAGCTATATGAGGTCATGGCAACAAAAACGAGGATCTACTTTGTTATGGAGTATTGTAAAGGTGGAGAGCTTTTCAACAAGGTTGCCAAAGGGAAATTGAGAGATGATGTTGCTTGGAAATACTTTTATCAGCTTATCAACGCAGTTGATTTTTGCCACAGCCGAGAGGTGTATCATCGTGACATAAAGCCGGAGAACCTATTGCTAGATGATAATGAGAATCTCAAGGTATCTGATTTCGGGTTAAGCGCCCTTGCTGACTGCAAGAGACAAGATGGCCTCCTCCACACTACTTGTGGTACACCTGCATATGTTGCTCCAGAAGTGATCAATCGAAAAGGCTATGATGGCACAAAAGCAGATATTTGGTCTTGTGGTGTGGTTTTGTTTGTCCTATTGGCAGGCTATCTACCTTTCCATGACTCCAATCTGATGGAGATGTACAGGAAGATAGGAAAAGCAGATTTTAAGGCACCAAGCTGGTTTGCTCCAGAAGTACGGAGGCTGTTGTGTAAGATGCTAGACCCTAACCCTGAAACTAGAATCACCATCGCAAGAATCAGGGAGAGTTCTTGGTTCAGAAAAGGTTTACATATGAAACAGAAAAAGATGGAGAAACGAGTCAAAGAGATAAACTCTGTGGAAGCTGGTACTGCAGGTACAAATGAGAACGGAGCAGGTCCAAGTGAGAATGGAGCAGGTCCAAGTGAAAACGGAGACAGGGTCACGGAGGAAAACCATACAGACGAACCTACAAATTTGAACGCTTTTGATTTAATTGCCTTGTCTGCTGGGTTTGATCTGGCAGGACTGTTTGGAGATGATAACAAGAGAGAATCTAGATTCACATCACAGAAACCTGCTTCAGTGATCATATCTAAGCTGGAGGAAGTAGCACAGCGATTGAAACTGAGCATAAGAAAGCGAGAAGCAGGTTTGTTCAAATTGGAACGATTAAAAGAAGGAAGAAAAGGGATTCTGTCGATGGATGCAGAAATATTTCAAGTGACGCCAAACTTTCATTTAGTGGAAGTGAAGAAATCAAATGGAGATACTCTCGAGTATCAGAAATTAGTAGCAGAGGATCTTAGACCTGCTCTGTCAGATATTGTATGGGTTTGGCAGGGTGAGAAAGATGAGCTTACTTCACAGCAAGAGACAGAATACcaacaacaacaacaacaagaacaacaagaacaGGAAGAACCATTGAAGTTTTGAAATTTGTTCTTGTCAAGTTTTTGGAATTTTGCTTAACACTGAATCACTGATGTTAATCGTATATGAGTTTCTTACATTTTTAATTTGTGGAAAAAAGGAATCCATCATAATATAAAGAAGTCGTTTAAAG


Protein sequences

Name Description Sequence
At.9578 translated coding region predicted by ESTScan from UniGene At.9578

MENKPSVLTDKYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEINSVEAGTAGTNENGAGPSENGAGPSENGDRVTEENHTDEPTNLNAFDLIALSAGFDLAGLFGDDNKRESRFTSQKPASVIISKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIFQVTPNFHLVEVKKSNGDTLEYQKLVAEDLRPALSDIVWVWQGEKDELTSQQETEYQQQQQQEQQEQEEPLKF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343:SF45
1-270 PTHR24343:SF45,SERINE/THREONINE-PROTEIN KINASE PTK1

MENKPSVLTDKYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFRKGL

HMMPanther: PTHR24343
1-270 PTHR24343,SERINE/THREONINE KINASE

MENKPSVLTDKYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFRKGL

Gene3D: G3DSA:3.30.200.20
3-108 G3DSA:3.30.200.20

NKPSVLTDKYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRD

superfamily: SSF56112
IPR011009
7-297 Kinase_like
Protein kinase-like domain

VLTDKYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEINSVEAGTAGTNEN

HMMPfam: PF00069
IPR017442
12-266 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWF

ProfileScan: PS50011
IPR000719
12-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWF

HMMSmart: SM00220
IPR002290
12-266 S_TKc
Serine/threonine-protein kinase domain

YDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMRIARHPNVVELYEVMATKTRIYFVMEYCKGGELFNKVAKGKLRDDVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWF

PatternScan: PS00107
IPR017441
18-41 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYYGRSILTNQSVAIK

Gene3D: G3DSA:1.10.510.10
109-309 G3DSA:1.10.510.10

DVAWKYFYQLINAVDFCHSREVYHRDIKPENLLLDDNENLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYDGTKADIWSCGVVLFVLLAGYLPFHDSNLMEMYRKIGKADFKAPSWFAPEVRRLLCKMLDPNPETRITIARIRESSWFRKGLHMKQKKMEKRVKEINSVEAGTAGTNENGAGPSENGAGPS

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDIKPENLLL

ProfileScan: PS50816
IPR018451
322-346 NAF
NAF/FISL domain

DEPTNLNAFDLIALSAGFDLAGLFG

HMMPfam: PF03822
IPR004041
323-381 NAF
NAF domain

EPTNLNAFDLIALSAGFDLAGLFGDDNKRESRFTSQKPASVIISKLEEVAQRLKLSIRK

Gene3D: G3DSA:3.30.310.80
IPR001772
354-433 Kinase-assoc_KA1
Kinase-associated KA1

RFTSQKPASVIISKLEEVAQRLKLSIRKREAGLFKLERLKEGRKGILSMDAEIFQVTPNFHLVEVKKSNGDTLEYQKLVA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox