PRGDB00065916 (At.9613)

From PRG Wiki
Jump to: navigation, search
At.9613
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 16649054 (AY059897)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana receptor protein kinase-like protein (At5g67200; K21H1.16) mRNA, complete cds

DNA Sequence

ACTaaaaaaaaatgacactgaacttttttcttcccttcttcttcttcttcattctCCTCCGTGTCTCCGCCGGAGCAGAGCCAAATTACTTCAACTCCTTACTTCCTTCCGACGCCGTTGCATTACTCTCTTTCAAATCCACCGCCGATCTCGACAACAAGCTCTTGTATTCACTCACCGAGCGTTACGACTACTGTCAATGGCGCGGCGTTAAATGTGCACAAGGACGCATCGTTCGTCTTGTTCTCTCCGGCGTTGGTCTCCGCGGCTACTTCTCTTCAGCTACTCTTAGCCGTCTTGACCAGCTCCGAGTTCTGAGTCTCGAGAATAACTCGCTCTTTGGTCCGATTCCTGATCTTTCACATCTCGTTAACCTCAAATCTCTCTTCCTTAGCCGGAATCAGTTTTCCGGTGCTTTCCCTCCGTCGATTCTCTCTCTGCACCGGTTAATGATTCTCTCTATATCCCACAACAACTTCTCCGGTTCGATTCCCTCTGAGATCAACGCACTTGACCGGTTAACTTCATTAAATCTCGACTTTAACCGGTTTAACGGAACTCTACCGTCGTTAAACCAGTCGTTTCTGACGTCATTCAACGTCTCCGGTAACAACCTCACCGGAGTAATCCCCGTTACTCCGACTCTATCACGTTTCGATGCGTCGTCGTTTAGGTCTAACCCTGGACTCTGCGGCGAGATCATTAACCGAGCTTGCGCTTCACGCTCGCCGTTCTTTGGCTCCACTAACAAAACGACGTCGTCAGAAGCTCCGTTAGGACAAAGCGCACAGGCGCAGAATGGTGGTGCGGTGGTTATCCCTCCGGTAGTTACGAAGAAGAAAGGTAAAGAAAGTGGATTAGTCCTTGGTTTCACCGCTGGTCTCGCTTCGCTTATAGTTCTTGGTCTTTGCCTCGTTGTGTTCTCTCTGGTGATAAAGAAACGAAACGACGATGGAATATATGAACCAAATCCAAAAGGAGAAGCTTCCTTATCTCAACAACAGCAATCACAAAACCAAACTCCAAGAACAAGAGCAGTTCCGGTTTTGAACTCAGATACCGAATCTCAAAAGCGAGAAAAAGAGGTTCAATTTCAAGAAACAGAGCAGCGAATACCAAATAGTGGGAATCTTGTTTTCTGTGGAGAATCTAGAAGTCAAGGAATGTACACAATGGAGCAGCTAATGAGAGCTTCAGCGGAGTTATTAGGAAGAGGATCAGTAGGGATTACGTATAAAGCGGTTCTTGATAATCAGCTTATTGTGACGGTGAAGAGACTAGACGCTGCTAAAACGGCAGTGACGAGTGAAGAAGCGTTTGAGAATCATATGGAGATTGTTGGTGGACTTAGACATACCAATCTTGTTCCGATTAGATCTTATTTTCAGTCCAACGGAGAGAGACTTATCATCTACGATTATCATCCTAATGGCAGCTTATTCAATCTCATTCACGGTTCAAGATCGTCAAGAGCAAAGCCATTACATTGGACATCATGTTTAAAGATTGCAGAAGATGTAGCTCAAGGCTTATATTACATCCACCAAACATCATCAGCATTAGTCCATGGAAACCTAAAATCCACAAACATTCTCTTAGGACAAGACTTTGAAGCCTGTTTAACAGATTACTGCCTCAGTGTCTTAACAGACTCTTCTTCTGCTTCACCTGATGATCCTGACTCATCCTCCTACAAAGCTCCTGAGATCAGAAAATCATCACGTAGACCAACTTCCAAATGTGATGTTTACTCGTTTGGTGTCTTGATCTTTGAGCTTTTGACTGGTAAGAATGCGTCAAGGCATCCGTTTATGGCGCCTCATGATATGCTTGATTGGGTTAGAGCAATGAGAGAAGAAGAAGAAGGAACAGAGGATAATAGGCTTGGGATGATGACTGAAACAGCTTGTCTTTGCCGTGTGACATCACCAGAGCAAAGACCAACGATGAGACAAGTGATTAAGATGATTCAGGAGATTAAGGAGAGTGTTATGGCTGAAGAAAACGATCCGTTCCGGTGAAAACGAAACTTCCTAGCTATCCTCCGAACAATTTTCCCAAGCGAGGGGGTTAATTTAGAGAAAGGAGAATATAGGGTGCGTGAATGTAATTTTGTTAGCATGTGGGGTTGGAATTGTAATACAGTTGGAATTTAGAGGACGAAAGTCAAAGAAGTTTGCTTTTTCTCT


Protein sequences

Name Description Sequence
At.9613 translated coding region predicted by ESTScan from UniGene At.9613

MTLNFFLPFFFFFILLRVSAGAEPNYFNSLLPSDAVALLSFKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIVRLVLSGVGLRGYFSSATLSRLDQLRVLSLENNSLFGPIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRLMILSISHNNFSGSIPSEINALDRLTSLNLDFNRFNGTLPSLNQSFLTSFNVSGNNLTGVIPVTPTLSRFDASSFRSNPGLCGEIINRACASRSPFFGSTNKTTSSEAPLGQSAQAQNGGAVVIPPVVTKKKGKESGLVLGFTAGLASLIVLGLCLVVFSLVIKKRNDDGIYEPNPKGEASLSQQQQSQNQTPRTRAVPVLNSDTESQKREKEVQFQETEQRIPNSGNLVFCGESRSQGMYTMEQLMRASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIKMIQEIKESVMAEENDPFR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-669 PTHR24420,FAMILY NOT NAMED

MTLNFFLPFFFFFILLRVSAGAEPNYFNSLLPSDAVALLSFKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIVRLVLSGVGLRGYFSSATLSRLDQLRVLSLENNSLFGPIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRLMILSISHNNFSGSIPSEINALDRLTSLNLDFNRFNGTLPSLNQSFLTSFNVSGNNLTGVIPVTPTLSRFDASSFRSNPGLCGEIINRACASRSPFFGSTNKTTSSEAPLGQSAQAQNGGAVVIPPVVTKKKGKESGLVLGFTAGLASLIVLGLCLVVFSLVIKKRNDDGIYEPNPKGEASLSQQQQSQNQTPRTRAVPVLNSDTESQKREKEVQFQETEQRIPNSGNLVFCGESRSQGMYTMEQLMRASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIKMIQEIKESVMAEENDPFR

superfamily: SSF52058
28-228 SSF52058,LRR

NSLLPSDAVALLSFKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIVRLVLSGVGLRGYFSSATLSRLDQLRVLSLENNSLFGPIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRLMILSISHNNFSGSIPSEINALDRLTSLNLDFNRFNGTLPSLNQSFLTSFNVSGNNLTGVIPVTPTLSRFDASSFRSNPGLCG

Gene3D: G3DSA:3.80.10.10
32-207 G3DSA:3.80.10.10

PSDAVALLSFKSTADLDNKLLYSLTERYDYCQWRGVKCAQGRIVRLVLSGVGLRGYFSSATLSRLDQLRVLSLENNSLFGPIPDLSHLVNLKSLFLSRNQFSGAFPPSILSLHRLMILSISHNNFSGSIPSEINALDRLTSLNLDFNRFNGTLPSLNQSFLTSFNVSGNNLTGVIP

HMMPfam: PF00560
IPR001611
98-119 LRR_1
Leucine-rich repeat

QLRVLSLENNSLFGPIPDLSHL

HMMPfam: PF00560
IPR001611
121-141 LRR_1
Leucine-rich repeat

NLKSLFLSRNQFSGAFPPSIL

HMMPfam: PF00560
IPR001611
146-165 LRR_1
Leucine-rich repeat

LMILSISHNNFSGSIPSEIN

superfamily: SSF56112
IPR011009
380-668 Kinase_like
Protein kinase-like domain

SRSQGMYTMEQLMRASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIKMIQEIKESVMAEENDPF

ProfileScan: PS50011
IPR000719
393-669 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIKMIQEIKESVMAEENDPFR

Gene3D: G3DSA:3.30.200.20
397-470 G3DSA:3.30.200.20

ELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDY

HMMPfam: PF00069
IPR017442
397-651 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ELLGRGSVGITYKAVLDNQLIVTVKRLDAAKTAVTSEEAFENHMEIVGGLRHTNLVPIRSYFQSNGERLIIYDYHPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIK

Gene3D: G3DSA:1.10.510.10
471-661 G3DSA:1.10.510.10

HPNGSLFNLIHGSRSSRAKPLHWTSCLKIAEDVAQGLYYIHQTSSALVHGNLKSTNILLGQDFEACLTDYCLSVLTDSSSASPDDPDSSSYKAPEIRKSSRRPTSKCDVYSFGVLIFELLTGKNASRHPFMAPHDMLDWVRAMREEEEGTEDNRLGMMTETACLCRVTSPEQRPTMRQVIKMIQEIKESVM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox