PRGDB00065917 (At.10013)

From PRG Wiki
Jump to: navigation, search
At.10013
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145339451 (NM_115208)
Gene Class N
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana PDR9 (PLEIOTROPIC DRUG RESISTANCE 9); ATPase, coupled to transmembrane movement of substances (PDR9) mRNA, complete cds

DNA Sequence

ATCTCTCATTTAGACTTTAAATTTCTGATTTCAGAGAGGTCAACTCTTTAAGCCAAGCCATGGCTCATATGGTTGGAGCAGACGATATTGAGTCATTGAGAGTAGAGCTTGCAGAGATCGGAAGAAGCATCAGATCATCATTCCGGAGACATACTTCGAGTTTCAGAAGCAGCTCTTCAATATATGAAGTTGAAAATGATGGTGATGTTAATGATCATGATGCAGAGTATGCTCTGCAATGGGCTGAGATTGAGAGATTACCAACTGTCAAGCGAATGAGATCGACTCTCCTTGATGATGGCGATGAGTCCATGACCGAGAAAGGAAGAAGAGTCGTTGATGTCACAAAGCTTGGAGCCGTGGAACGTCATCTGATGATTGAGAAACTCATCAAACACATTGAGAATGATAATCTCAAGTTGCTCAAGAAAATCAGGAGAAGAATAGACAGAGTCGGGATGGAGTTACCGACCATAGAAGTGAGGTACGAGAGTTTAAAAGTGGTGGCCGAGTGCGAGGTTGTCGAAGGGAAGGCACTTCCAACACTGTGGAACACTGCTAAGCGTGTTTTATCTGAACTGGTGAAGCTCACTGGTGCAAAAACACATGAAGCCAAGATAAACATTATTAATGATGTTAATGGCATTATAAAGCCAGGAAGGTTAACACTGTTGCTTGGTCCTCCTAGCTGCGGAAAAACAACTTTGTTAAAGGCCTTGTCTGGAAATTTAGAAAACAATCTAAAGTGTTCAGGTGAAATATCTTACAATGGACACAGACTGGATGAGTTTGTTCCTCAGAAAACTTCAGCGTACATAAGTCAATATGATCTGCACATTGCAGAGATGACAGTGAGGGAGACAGTTGACTTCTCAGCTCGTTGTCAGGGCGTTGGTAGCCGAACAGATATTATGATGGAAGTTAGTAAAAGAGAAAAGGAAAAAGGAATCATTCCTGACACAGAAGTGGATGCTTACATGAAAGCAATTTCTGTTGAAGGACTCCAAAGAAGTCTGCAAACAGATTACATTTTGAAGATTCTCGGACTTGATATTTGTGCAGAAATATTGATTGGAGATGTGATGAGGAGAGGTATATCAGGAGGTCAAAAGAAGCGTCTTACCACAGCTGAGATGATCGTTGGCCCGACAAAGGCTCTGTTTATGGATGAAATAACAAATGGCCTAGACAGCTCCACAGCTTTTCAGATTGTCAAATCTCTTCAGCAGTTTGCTCACATATCAAGCGCTACTGTACTTGTTTCGCTTCTTCAACCCGCCCCAGAATCCTATGACCTCTTTGATGACATTATGCTGATGGCCAAAGGAAGAATCGTGTATCATGGTCCACGCGGTGAAGTCCTTAACTTCTTTGAGGATTGTGGATTCCGATGCCCTGAAAGGAAGGGTGTTGCAGACTTTCTCCAGGAGGTTATATCCAAAAAAGATCAAGCACAATACTGGTGGCACGAGGATTTACCTTACAGTTTTGTCTCGGTAGAAATGTTGTCGAAGAAGTTCAAGGACTTGAGTATTGGGAAAAAGATCGAAGACACTCTGTCAAAGCCATATGATAGATCCAAAAGCCATAAGGATGCTTTGTCCTTCAGTGTGTATTCTCTTCCAAACTGGGAGCTGTTCATAGCATGCATATCAAGAGAGTATCTTCTCATGAAGAGAAACTATTTCGTCTATATTTTCAAGACTGCTCAGCTTGTTATGGCCGCATTCATCACTATGACAGTGTTTATCCGAACACGGATGGGTATTGATATCATTCATGGAAATTCTTACATGAGTGCCCTCTTTTTCGCCCTCATTATACTTCTTGTTGACGGATTCCCAGAGTTGTCTATGACGGCTCAACGTCTAGCCGTGTTTTATAAGCAGAAGCAGTTGTGTTTCTATCCTGCATGGGCGTATGCAATCCCTGCAACAGTGTTAAAGGTCCCTCTCTCGTTCTTTGAATCTCTCGTTTGGACCTGCCTCTCATACTATGTCATTGGATACACCCCTGAAGCATCCAGGTTCTTCAAGCAGTTCATTCTACTCTTTGCTGTTCACTTCACCTCGATATCCATGTTCCGGTGTCTAGCTGCAATCTTCCAGACAGTAGTTGCTTCAATCACAGCTGGCAGTTTTGGTATATTATTCACATTTGTCTTTGCCGGTTTCGTCATTCCACCACCTTCTATGCCAGCATGGCTCAAGTGGGGTTTCTGGGCAAATCCTTTGAGTTACGGTGAGATTGGGTTATCAGTAAACGAGTTTCTTGCTCCAAGGTGGAATCAGATGCAACCCAATAATTTTACCTTAGGACGAACCATACTCCAAACCCGTGGAATGGACTACAACGGTTACATGTACTGGGTATCATTATGTGCCTTGTTGGGTTTCACTGTGCTCTTCAACATCATTTTCACTCTGGCTCTAACGTTCTTGAAATCACCCACATCATCTCGAGCCATGATTTCGCAAGACAAACTCTCTGAGCTGCAAGGAACAGAAAAGTCAACAGAAGATTCTTCTGTCAGGAAAAAGACCACAGACTCCCCTGTAAAGACCGAAGAAGAAGACAAAATGGTCTTACCATTCAAGCCTCTCACTGTAACATTTCAAGACTTGAACTATTTCGTTGACATGCCAGTGGAGATGAGAGACCAAGGATATGATCAGAAGAAACTACAACTTCTCTCAGATATCACAGGAGCTTTCCGTCCCGGAATCCTAACGGCACTAATGGGAGTGAGTGGAGCTGGAAAAACCACTCTTCTCGACGTTCTAGCCGGAAGGAAAACAAGCGGATACATCGAAGGAGACATTAGAATCAGTGGCTTCCCTAAAGTCCAAGAAACATTCGCTAGAGTCTCAGGCTACTGTGAACAAACAGATATTCACTCACCAAACATCACTGTAGAAGAATCCGTAATCTACTCGGCTTGGCTTCGTCTAGCTCCTGAGATCGATGCCACAACAAAAACCAAATTCGTGAAGCAAGTGCTTGAGACGATCGAATTAGATGAGATTAAAGATTCATTGGTGGGAGTCACCGGAGTTAGTGGATTATCGACGGAGCAAAGGAAGAGATTGACGATTGCGGTGGAGTTGGTGGCGAATCCGTCGATTATATTTATGGATGAGCCAACGACGGGGCTAGACGCAAGAGCAGCTGCCATTGTTATGAGAGCTGTGAAGAACGTCGCTGATACTGGACGAACCATCGTCTGTACTATTCATCAGCCTAGTATCGACATTTTTGAAGCCTTCGACGAGCTGGTGCTTCTTAAAAGAGGTGGTCGCATGATCTACACAGGACCATTAGGCCAACATTCACGTCACATTATCGAGTATTTTGAGAGTGTTCCTGAAATTCCTAAAATAAAAGACAACCACAATCCAGCAACATGGATGCTTGATGTTAGTTCACAGTCGGTAGAAATTGAACTTGGTGTCGATTTCGCAAAAATCTACCATGACTCTGCTCTTTACAAGCGAAACTCAGAGCTTGTGAAACAGTTGAGCCAGCCAGATTCAGGATCAAGTGATATACAGTTTAAGAGAACCTTTGCACAAAGCTGGTGGGGACAATTCAAATCTATTCTATGGAAAATGAACTTGTCTTATTGGAGAAGCCCTTCTTATAACCTAATGCGTATGATGCACACTTTAGTCTCTTCTTTGATCTTCGGCGCACTTTTCTGGAAACAAGGCCAAAATCTAGATACTCAACAGAGTATGTTCACAGTATTTGGAGCGATCTACGGTTTGGTACTCTTCTTAGGGATAAACAATTGTGCATCAGCTCTTCAATATTTCGAAACAGAGAGAAATGTTATGTACCGGGAAAGATTCGCAGGGATGTACTCAGCGACTGCTTATGCATTGGGTCAAGTGGTGACTGAGATACCTTATATATTCATACAAGCTGCCGAGTTTGTGATCGTAACATATCCAATGATCGGTTTCTATCCTTCAGCCTACAAAGTCTTTTGGTCACTCTACTCTATGTTTTGCTCACTACTCACTTTCAACTACCTTGCGATGTTCCTCGTCTCCATCACGCCAAACTTCATGGTTGCCGCGATTCTTCAATCGCTCTTTTATGTTGGTTTCAACCTTTTTTCGGGGTTTTTGATCCCCCAAACGCAAGTACCAGGGTGGTGGATTTGGTTATATTATCTAACACCAACGTCTTGGACACTCAACGGGTTTATCTCGTCCCAATACGGCGATATTCATGAAGAGATCAATGTCTTTGGACAATCCACGACGGTTGCAAGATTCTTGAAAGACTATTTTGGATTTCATCATGACCTTTTGGCGGTTACCGCGGTTGTTCAAATCGCTTTTCCCATTGCCTTAGCTTCTATGTTTGCATTCTTCGTGGGCAAACTCAACTTCCAACGAAGATGATCATGCCAATTAGTCTTCATCAATCATCATTTTAGAataaaataataaaataatggtttttatttttgtttgtgaaaataaacatataacatataaCTTTTCTTTTTGGTATGTATATGATTTTGAGGAAAGTAAACAAAGCATTGTCTATGC


Protein sequences

Name Description Sequence
At.10013 translated coding region predicted by ESTScan from UniGene At.10013

MAHMVGADDIESLRVELAEIGRSIRSSFRRHTSSFRSSSSIYEVENDGDVNDHDAEYALQWAEIERLPTVKRMRSTLLDDGDESMTEKGRRVVDVTKLGAVERHLMIEKLIKHIENDNLKLLKKIRRRIDRVGMELPTIEVRYESLKVVAECEVVEGKALPTLWNTAKRVLSELVKLTGAKTHEAKINIINDVNGIIKPGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLNFFEDCGFRCPERKGVADFLQEVISKKDQAQYWWHEDLPYSFVSVEMLSKKFKDLSIGKKIEDTLSKPYDRSKSHKDALSFSVYSLPNWELFIACISREYLLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALFFALIILLVDGFPELSMTAQRLAVFYKQKQLCFYPAWAYAIPATVLKVPLSFFESLVWTCLSYYVIGYTPEASRFFKQFILLFAVHFTSISMFRCLAAIFQTVVASITAGSFGILFTFVFAGFVIPPPSMPAWLKWGFWANPLSYGEIGLSVNEFLAPRWNQMQPNNFTLGRTILQTRGMDYNGYMYWVSLCALLGFTVLFNIIFTLALTFLKSPTSSRAMISQDKLSELQGTEKSTEDSSVRKKTTDSPVKTEEEDKMVLPFKPLTVTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQHSRHIIEYFESVPEIPKIKDNHNPATWMLDVSSQSVEIELGVDFAKIYHDSALYKRNSELVKQLSQPDSGSSDIQFKRTFAQSWWGQFKSILWKMNLSYWRSPSYNLMRMMHTLVSSLIFGALFWKQGQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMYRERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSLLTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWTLNGFISSQYGDIHEEINVFGQSTTVARFLKDYFGFHHDLLAVTAVVQIAFPIALASMFAFFVGKLNFQRR

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
174-451 SSF52540

LVKLTGAKTHEAKINIINDVNGIIKPGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLNFFEDCGFRCPERKGV

ProfileScan: PS50893
IPR003439
175-447 ABC_TRANSPORTER_2
ABC transporter-like

VKLTGAKTHEAKINIINDVNGIIKPGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLNFFEDCGFRCPE

Gene3D: G3DSA:3.40.50.300
175-436 G3DSA:3.40.50.300

VKLTGAKTHEAKINIINDVNGIIKPGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLN

HMMSmart: SM00382
IPR003593
199-433 AAA,NBS
ATPase, AAA+ type, core

PGRLTLLLGPPSCGKTTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITNGLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGE

HMMPfam: PF00005
IPR003439
214-374 ABC_tran
ABC transporter-like

TTLLKALSGNLENNLKCSGEISYNGHRLDEFVPQKTSAYISQYDLHIAEMTVRETVDFSARCQGVGSRTDIMMEVSKREKEKGIIPDTEVDAYMKAISVEGLQRSLQTDYILKILGLDICAEILIGDVMRRGISGGQKKRLTTAEMIVGPTKALFMDEITN

HMMPanther: PTHR19241
375-1450 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

GLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLNFFEDCGFRCPERKGVADFLQEVISKKDQAQYWWHEDLPYSFVSVEMLSKKFKDLSIGKKIEDTLSKPYDRSKSHKDALSFSVYSLPNWELFIACISREYLLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALFFALIILLVDGFPELSMTAQRLAVFYKQKQLCFYPAWAYAIPATVLKVPLSFFESLVWTCLSYYVIGYTPEASRFFKQFILLFAVHFTSISMFRCLAAIFQTVVASITAGSFGILFTFVFAGFVIPPPSMPAWLKWGFWANPLSYGEIGLSVNEFLAPRWNQMQPNNFTLGRTILQTRGMDYNGYMYWVSLCALLGFTVLFNIIFTLALTFLKSPTSSRAMISQDKLSELQGTEKSTEDSSVRKKTTDSPVKTEEEDKMVLPFKPLTVTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQHSRHIIEYFESVPEIPKIKDNHNPATWMLDVSSQSVEIELGVDFAKIYHDSALYKRNSELVKQLSQPDSGSSDIQFKRTFAQSWWGQFKSILWKMNLSYWRSPSYNLMRMMHTLVSSLIFGALFWKQGQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMYRERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSLLTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWTLNGFISSQYGDIHEEINVFGQSTTVARFLKDYFGFHHDLLAVTAVVQIAFPIALASMFAFFVGKLNFQRR

HMMPanther: PTHR19241:SF10
375-1450 PTHR19241:SF10,ATP-BINDING CASSETTE TRANSPORTER (PDR)

GLDSSTAFQIVKSLQQFAHISSATVLVSLLQPAPESYDLFDDIMLMAKGRIVYHGPRGEVLNFFEDCGFRCPERKGVADFLQEVISKKDQAQYWWHEDLPYSFVSVEMLSKKFKDLSIGKKIEDTLSKPYDRSKSHKDALSFSVYSLPNWELFIACISREYLLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALFFALIILLVDGFPELSMTAQRLAVFYKQKQLCFYPAWAYAIPATVLKVPLSFFESLVWTCLSYYVIGYTPEASRFFKQFILLFAVHFTSISMFRCLAAIFQTVVASITAGSFGILFTFVFAGFVIPPPSMPAWLKWGFWANPLSYGEIGLSVNEFLAPRWNQMQPNNFTLGRTILQTRGMDYNGYMYWVSLCALLGFTVLFNIIFTLALTFLKSPTSSRAMISQDKLSELQGTEKSTEDSSVRKKTTDSPVKTEEEDKMVLPFKPLTVTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQHSRHIIEYFESVPEIPKIKDNHNPATWMLDVSSQSVEIELGVDFAKIYHDSALYKRNSELVKQLSQPDSGSSDIQFKRTFAQSWWGQFKSILWKMNLSYWRSPSYNLMRMMHTLVSSLIFGALFWKQGQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMYRERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSLLTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWTLNGFISSQYGDIHEEINVFGQSTTVARFLKDYFGFHHDLLAVTAVVQIAFPIALASMFAFFVGKLNFQRR

HMMPfam: PF01061
IPR013525
526-737 ABC2_membrane
ABC-2 type transporter

LFIACISREYLLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALFFALIILLVDGFPELSMTAQRLAVFYKQKQLCFYPAWAYAIPATVLKVPLSFFESLVWTCLSYYVIGYTPEASRFFKQFILLFAVHFTSISMFRCLAAIFQTVVASITAGSFGILFTFVFAGFVIPPPSMPAWLKWGFWANPLSYGEIGLSVNEF

HMMPfam: PF08370
IPR013581
742-805 PDR_assoc
Plant PDR ABC transporter associated

WNQMQPNNFTLGRTILQTRGMDYNGYMYWVSLCALLGFTVLFNIIFTLALTFLKSPTSSRAMIS

superfamily: SSF52540
842-1089 SSF52540

VLPFKPLTVTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQ

ProfileScan: PS50893
IPR003439
850-1103 ABC_TRANSPORTER_2
ABC transporter-like

VTFQDLNYFVDMPVEMRDQGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQHSRHIIEYFESVPE

Gene3D: G3DSA:3.40.50.300
868-1090 G3DSA:3.40.50.300

QGYDQKKLQLLSDITGAFRPGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGGRMIYTGPLGQH

HMMSmart: SM00382
IPR003593
887-1079 AAA,NBS
ATPase, AAA+ type, core

PGILTALMGVSGAGKTTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTTGLDARAAAIVMRAVKNVADTGRTIVCTIHQPSIDIFEAFDELVLLKRGG

HMMPfam: PF00005
IPR003439
902-1030 ABC_tran
ABC transporter-like

TTLLDVLAGRKTSGYIEGDIRISGFPKVQETFARVSGYCEQTDIHSPNITVEESVIYSAWLRLAPEIDATTKTKFVKQVLETIELDEIKDSLVGVTGVSGLSTEQRKRLTIAVELVANPSIIFMDEPTT

HMMPfam: PF01061
IPR013525
1176-1389 ABC2_membrane
ABC-2 type transporter

QFKSILWKMNLSYWRSPSYNLMRMMHTLVSSLIFGALFWKQGQNLDTQQSMFTVFGAIYGLVLFLGINNCASALQYFETERNVMYRERFAGMYSATAYALGQVVTEIPYIFIQAAEFVIVTYPMIGFYPSAYKVFWSLYSMFCSLLTFNYLAMFLVSITPNFMVAAILQSLFYVGFNLFSGFLIPQTQVPGWWIWLYYLTPTSWTLNGFISSQY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox