PRGDB00065918 (At.10378)

From PRG Wiki
Jump to: navigation, search
At.10378
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337316 (NM_105589)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SIK1; ATP binding

DNA Sequence

GCCTGActctctttctctctctcCCGGCGACGACGGTTTAGAGTCGCCATAGATGGATCATAACTCGCCGAAATCTCGTCGGAGCCGGAAACCGGAGCCCAAACCTGACATATACTCCACTTTCGTAGTCCACTCCGACTCTGATTCTGATCAAGGTCGAGATCGAGACAAACGTAAAGCCAAACCTGAGGAAGACGAAAATGTCGATTTATACGCTACAATGGTCTACAAAGGCGATAGTGACGGAGAAGGAGAGGAAGATGATGATGACGATTCTATGCTTCCTCCTCTTCTCAAGCGTCTTCCCAAGGATTTCGGAGGCGGCGCGTCGCTCGATTACGACGACGACGACGGTGATGAATCTGGAGATTTCGGTACGATGATTGTGAAAACAGATCGGAGTAGTCATAGTAAGAAGAACAGTCCGTACTCGTCCAAACCGCGAATGGGAGTTAGTCCTAGGAGGAGAGCGAGAGGCGGagatgaggaatcttctgatgaagaagacgaagaagaagatgatgatgacgacgacggagactacggTACGTTTGTTGTGAAATCTAAGGATAAAAAGGGAAAGAAGAAAGACAAGGAGATTGATATGACAACTATGGGAAGAGCTGTTGCGAGTATGCAGAAATCAAATTTTGGTGGTAAGACTCGGAAATTGGATCCTTCCTCTTCTTCTTCGAAACTTCACGGTGAAGATAATCGGAAAATGCAGCAGCAAAACAGTAAGATGTCGACTACGTCTCTTCCGGATAGCATTACTAGAGAAGATCCAACCACCAAATACGAATTCCTCAATGAACTTGGGAAAGGATCATATGGATCTGTATACAAGGCAAGAGATTTGAAAACATCAGAGATTGTTGCTGTGAAAGTCATATCACTTACTGAAGGGGAGGAGGGGTATGAAGAGATCCGGGGAGAAATTGAGATGCTGCAGCAATGTAATCATCCTAATGTTGTCCGCTACCTAGGGAGTTACCAAGGAGAAGATTATCTTTGGATAGTGATGGAGTATTGTGGAGGTGGAAGTGTTGCTGATCTTATGAATGTTACTGAGGAGGCGTTAGAGGAGTATCAGATAGCATATATATGTCGGGAGGCGTTGAAGGGCCTTGCATACTTGCACTCAATATATAAAGTCCATAGAGACATTAAAGGTGGAAATATCTTGTTAACTGAACAAGGAGAGGTCAAGTTGGGTGACTTTGGGGTTGCAGCTCAACTTACTCGCACTATGTCGAAGCGAAACACGTTCATTGGGACTCCACATTGGATGGCCCCAGAGGTTATTCAGGAAAATCGTTATGATGGGAAGGTTGATGTATGGGCTCTTGGTGTTTCAGCTATTGAGATGGCAGAGGGGCTCCCTCCAAGATCATCAGTTCATCCGATGAGGGTTTTGTTCATGATATCCATCGAGCCAGCTCCAATGCTCGAGGATAAAGAAAAATGGTCCCTGGTCTTTCATGATTTTGTTGCAAAGTGCCTCACAAAGGAACCACGTCTTCGCCCAACTGCAGCTGAGATGCTTAAGCACAAATTTGTTGAGAGATGTAAAACTGGGGCTTCTGCAATGTCGCCAAAGATTGAGAAGTCCAGACAAATCAGAGCTACAATGGCTCTGCAAGCGCAAAGTGTTGTCGCACCTTCTTTGGAGGACACTTCAACACTGGGTCCAAAATCAAGCGAGGAGCTTGGAATTACTGTTCCATCTAAACCTCCTCAAAATTCGACCGAAGCACCTCTAACCAGCACCCTGAATCGGCAGCATATTACTGGCAACACTGTGTTGGCTGGAGAAGGTGGTGACTTCGGAACTATGATCGTTCATGGTGAGGATGAGACAGAGGAGAGTGACTCCAGGTCTCAGCTTGTCAGAGAAAAAGAATCTTCATCTTCTCAGTTTGAAGGTGTTCCTCGCGAATTCCCAGGAGAAGAATTACCTGACTCATGGATACATGACAAAAAGAAGCCTCCGGCTATTGATCTTCCAGTTGAAGCTTCGATTTCACAGAGCATGCAGGCAAGTTCATCTCATGAGCATAGAACCAAGCTACATAACATAGCTGGAACACAGATGGAAGGTGGCAGTGATGCAAGTGGTAGTACCTTGAAAAATGAAACTGTTGGCAGGAAAGCTTTTGCTTTGCAAGATAAGTTATGGTCAATCTACGCAGCTGGAAACACAGTACCGATACCGTTCTTGAGAGCAACAGATATATCCCCAATCGCACTCTTGTCAGAGAACATGATCGGAGGCATGCAACAAGATGGGAATGGAACTGTAGCCGTCGAAGCACTTCAGGAGCTCTTCACTTCTTCTGATCCCCAATCCAAAAAGGGCCGACGTGGACAAAACGAGATGCCTCTTCCTCCAAGCGTATACCAAAGACTGACAACAAGCTCTTCTCTGATGAACCTTGCACAAGTTTTAGCCTACCACAGAGCGTGTTACGAGGAAATGCCGCTGCAGGAATTGCAAGCAACGCAGGAGCAGCAAACCATTCAGAATCTGTGCGATACTCTTCGCACTATTCTCCGCCTCTAAATAGTCTTGTGTTCATATCTGTTGCTACTCTTGTATTAGTATAGGTCGTCTCAGCAAGTACATGTTTATTTTCCTAGAAGTTTTTATTAAAAACCAATCAATTTTGTCTCCTCTTAGCACAATTGCTAGAAGATTGAATGGAACAAACGGATTTTGTAACACTCGTATAAATAGTATCCCCTTAGGTTTAATAATAAATACTATTACAA


Protein sequences

Name Description Sequence
At.10378 translated coding region predicted by ESTScan from UniGene At.10378

MDHNSPKSRRSRKPEPKPDIYSTFVVHSDSDSDQGRDRDKRKAKPEEDENVDLYATMVYKGDSDGEGEEDDDDDSMLPPLLKRLPKDFGGGASLDYDDDDGDESGDFGTMIVKTDRSSHSKKNSPYSSKPRMGVSPRRRARGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKDKEIDMTTMGRAVASMQKSNFGGKTRKLDPSSSSSKLHGEDNRKMQQQNSKMSTTSLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFVERCKTGASAMSPKIEKSRQIRATMALQAQSVVAPSLEDTSTLGPKSSEELGITVPSKPPQNSTEAPLTSTLNRQHITGNTVLAGEGGDFGTMIVHGEDETEESDSRSQLVREKESSSSQFEGVPREFPGEELPDSWIHDKKKPPAIDLPVEASISQSMQASSSHEHRTKLHNIAGTQMEGGSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNGTVAVEALQELFTSSDPQSKKGRRGQNEMPLPPSVYQRLTTSSSLMNLAQVLAYHRACYEEMPLQELQATQEQQTIQNLCDTLRTILRL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361:SF93
14-828 PTHR24361:SF93,STE20-RELATED KINASE ADAPTER PROTEIN BETA

PEPKPDIYSTFVVHSDSDSDQGRDRDKRKAKPEEDENVDLYATMVYKGDSDGEGEEDDDDDSMLPPLLKRLPKDFGGGASLDYDDDDGDESGDFGTMIVKTDRSSHSKKNSPYSSKPRMGVSPRRRARGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKDKEIDMTTMGRAVASMQKSNFGGKTRKLDPSSSSSKLHGEDNRKMQQQNSKMSTTSLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFVERCKTGASAMSPKIEKSRQIRATMALQAQSVVAPSLEDTSTLGPKSSEELGITVPSKPPQNSTEAPLTSTLNRQHITGNTVLAGEGGDFGTMIVHGEDETEESDSRSQLVREKESSSSQFEGVPREFPGEELPDSWIHDKKKPPAIDLPVEASISQSMQASSSHEHRTKLHNIAGTQMEGGSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNGTVAVEALQELFTSSDPQSKKGRRGQNEMPLPPSVYQRLTTSSSLMNLAQVLAYHRACYEEMPLQELQATQEQQTIQNLCD

HMMPanther: PTHR24361
14-828 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

PEPKPDIYSTFVVHSDSDSDQGRDRDKRKAKPEEDENVDLYATMVYKGDSDGEGEEDDDDDSMLPPLLKRLPKDFGGGASLDYDDDDGDESGDFGTMIVKTDRSSHSKKNSPYSSKPRMGVSPRRRARGGDEESSDEEDEEEDDDDDDGDYGTFVVKSKDKKGKKKDKEIDMTTMGRAVASMQKSNFGGKTRKLDPSSSSSKLHGEDNRKMQQQNSKMSTTSLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFVERCKTGASAMSPKIEKSRQIRATMALQAQSVVAPSLEDTSTLGPKSSEELGITVPSKPPQNSTEAPLTSTLNRQHITGNTVLAGEGGDFGTMIVHGEDETEESDSRSQLVREKESSSSQFEGVPREFPGEELPDSWIHDKKKPPAIDLPVEASISQSMQASSSHEHRTKLHNIAGTQMEGGSDASGSTLKNETVGRKAFALQDKLWSIYAAGNTVPIPFLRATDISPIALLSENMIGGMQQDGNGTVAVEALQELFTSSDPQSKKGRRGQNEMPLPPSVYQRLTTSSSLMNLAQVLAYHRACYEEMPLQELQATQEQQTIQNLCD

Gene3D: G3DSA:3.30.200.20
227-327 G3DSA:3.30.200.20

QNSKMSTTSLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYC

superfamily: SSF56112
IPR011009
235-504 Kinase_like
Protein kinase-like domain

SLPDSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFVE

HMMPfam: PF00069
IPR017442
249-503 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFV

ProfileScan: PS50011
IPR000719
249-503 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFV

HMMSmart: SM00220
IPR002290
249-503 S_TKc
Serine/threonine-protein kinase domain

YEFLNELGKGSYGSVYKARDLKTSEIVAVKVISLTEGEEGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFV

PatternScan: PS00107
IPR017441
255-278 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSYGSVYKARDLKTSEIVAVK

Gene3D: G3DSA:1.10.510.10
329-564 G3DSA:1.10.510.10

GGSVADLMNVTEEALEEYQIAYICREALKGLAYLHSIYKVHRDIKGGNILLTEQGEVKLGDFGVAAQLTRTMSKRNTFIGTPHWMAPEVIQENRYDGKVDVWALGVSAIEMAEGLPPRSSVHPMRVLFMISIEPAPMLEDKEKWSLVFHDFVAKCLTKEPRLRPTAAEMLKHKFVERCKTGASAMSPKIEKSRQIRATMALQAQSVVAPSLEDTSTLGPKSSEELGITVPSKPPQN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox