PRGDB00065919 (At.10473)

From PRG Wiki
Jump to: navigation, search
At.10473
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 110737443 (AK228766)
Gene Class Unknown
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana mRNA for putative dimethylaniline monooxygenase, complete cds, clone: RAFL16-09-F08

DNA Sequence

ACACACATACACTTACATCTCCATCCTCTTGTcttaaaaagtttccaaaatctttcttttttcttcttctacattcttaaaatttcttctgttttcTCCTCACAACCAGACAAGCAAACTCTAAACTCTGTGGAAGATGTATGGAAATAATAACAAGAAGTCTATCAACATCACGAGTATGTTTCAAAACCTCATCCCCGAAGGCAGCGACATTTTCTCCCGGCGTTGCATCTGGGTCAATGGACCCGTCATCGTCGGAGCTGGCCCATCAGGTCTAGCCGTTGCTGCGGGCTTGAAACGTGAAGGGGTACCATTCATAATCCTCGAGCGAGCTAACTGCATTGCTTCATTATGGCAAAACAGAACCTACGATCGTCTCAAACTCCATCTACCTAAACAGTTTTGCCAATTACCCAATTATCCTTTCCCGGACGAGTTCCCTGAGTACCCTACCAAGTTTCAGTTTATTCAGTACCTTGAGTCCTACGCAGCCAACTTTGACATCAACCCTAAGTTCAACGAGACAGTCCAGTCCGCTAAATATGATGAGACGTTCGGGCTGTGGCGGGTTAAGACCATTTCAAACATGGGTCAGCTCGGTTCTTGCGAGTTTGAGTATATATGCAGATGGATTGTGGTGGCAACGGGAGAGAACGCTGAGAAAGTTGTGCCGGATTTTGAAGGTCTAGAGGATTTTGGCGGCGATGTTCTCCATGCTGGTGACTATAAATCCGGTGGAAGGTACCAAGGGAAAAAGGTTTTGGTGGTGGGATGTGGAAACTCCGGTATGGAAGTCTCTCTCGATCTCTACAATCACGGAGCAAACCCATCGATGGTCGTTCGTAGCGCTGTTCATGTTTTACCAAGAGAGATTTTTGGGAAATCAACGTTTGAATTAGGAGTTACGATGATGAAGTATATGCCCGTTTGGCTCGCGGACAAGACTATACTCTTTCTGGCGAGGATTATCTTGGGGAATACCGATAAATACGGTCTAAAAAGGCCGAAAATTGGACCGTTAGAGCTAAAGAACAAGGAAGGCAAAACTCCGGTTCTTGACATCGGAGCGTTACCCAAAATCAGATCGGGAAAGATCAAAATCGTCCCCGGAATCATAAAGTTCGGCAAAGGCAAAGTTGAGCTAATAGATGGCCGTGTTCTTGAGATTGATTCCGTTATTCTAGCTACTGGATACAGAAGCAACGTCCCTTCATGGCTTAAGGACAACGACTTCTTCTCCGATGATGGGATACCAAAAAACCCGTTTCCAAACGGATGGAAAGGAGAGGCGGGATTGTATGCGGTAGGGTTCACGAGAAAAGGATTGTTTGGTGCGTCGCTTGATGCTATGAGTGTGGCTCATGATATTGCTAATAGGTGGAAAGAAGAGTCTAAGCAACAGAAGAAAACTGCTGCTGCTCGTCATCGTCGTTGTATTTCACATTTCTAATCATCATTATCAAATTTAGGGaaaaaaatattcaaaaaaaGAAGAAGATAATTAAGCCCTCTCCTCGGAAGAAAATACCCCCaaaaaaaagagaattgtgaaaagaaaaaaataatagggggatttttctttgtttttttaggaagatgtggcttttttatgtatttttattttaagagtgctttattttgttgttgtattttttttAAATCTTCATTTTAGATTTTGAACTCTTGTAAGAAGTTTTGCTTAATCTAATATGACAAATATATTTTACGGTTTTGTaaaaaaaaaG


Protein sequences

Name Description Sequence
At.10473 translated coding region predicted by ESTScan from UniGene At.10473

MYGNNNKKSINITSMFQNLIPEGSDIFSRRCIWVNGPVIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIVPGIIKFGKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQKKTAAARHRRCISHF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
2-432 PTHR23023:SF5,MONOOXYGENASE

YGNNNKKSINITSMFQNLIPEGSDIFSRRCIWVNGPVIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIVPGIIKFGKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQKKTAAARHRR

HMMPanther: PTHR23023
2-432 PTHR23023,DIMETHYLANILINE MONOOXYGENASE

YGNNNKKSINITSMFQNLIPEGSDIFSRRCIWVNGPVIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIVPGIIKFGKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQKKTAAARHRR

FPrintScan: PR00469
IPR000103
36-58 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

GPVIVGAGPSGLAVAAGLKREGV

FPrintScan: PR00368
IPR013027
37-56 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

PVIVGAGPSGLAVAAGLKRE

Gene3D: G3DSA:3.50.50.60
38-184 G3DSA:3.50.50.60

VIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGL

superfamily: SSF51905
38-323 SSF51905

VIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIV

HMMPfam: PF00743
IPR020946
39-358 FMO-like
Flavin-containing monooxygenase-like

IVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIVPGIIKFGKGKVELIDGRVLEIDSVILATGYRSNVP

FPrintScan: PR00368
IPR013027
163-181 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

CRWIVVATGENAEKVVPDF

Gene3D: G3DSA:3.50.50.60
185-244 G3DSA:3.50.50.60

EDFGGDVLHAGDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPR

FPrintScan: PR00469
IPR000103
203-227 PNDRDTASEII
Pyridine nucleotide-disulphide oxidoreductase, cla

YQGKKVLVVGCGNSGMEVSLDLYNH

FPrintScan: PR00368
IPR013027
207-225 FADPNR
FAD-dependent pyridine nucleotide-disulphide oxido

KVLVVGCGNSGMEVSLDLY

Gene3D: G3DSA:3.50.50.60
318-340 G3DSA:3.50.50.60

GKIKIVPGIIKFGKGKVELIDGR

superfamily: SSF51905
330-422 SSF51905

GKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQ

Gene3D: G3DSA:3.50.50.60
341-418 G3DSA:3.50.50.60

VLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox