PRGDB00065920 (At.10625)

From PRG Wiki
Jump to: navigation, search
At.10625
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 13809917 (AY026364)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat

DNA Sequence

ATAATTAGTAAAATTGGGTTTCTTGACCCATAAGCAATGTTgttccctcctcttcgttccctctttctcttcaccctcttgctctcctccGTTTGTTTCTTACAAATCAAAGCAGACCACGACGATGAAAGCGACTTGGGCAGTGATATCAAAGTAGACAAACGTCTCAAGTTCGAGAACCCGAAGCTACGTCAAGCCTACATTGCTCTTCAATCATGGAAAAAAGCAATCTTTTCTGATCCTTTCAACTTCACAGCTAATTGGAATGGTTCAGATGTTTGCTCCTACAATGGAATCTATTGTGCTCCTTCTCCTTCATACCCGAAAACCCGAGTCGTTGCTGGCATTGACCTCAACCACGCTGACATGGCCGGTTACTTGGCTTCCGAGCTAGGTCTCCTCTCTGATCTCGCTCTGTTCCACATTAACTCAAACCGTTTCTGCGGTGAAGTCCCTCTCACGTTTAACCGCATGAAGCTTCTCTACGAGCTTGATCTTAGCAACAACCGATTCGTCGGTAAGTTCCCTAAGGTTGTCCTCTCTTTGCCTTCCCTTAAATTCTTGGATCTCCGCTACAACGAGTTTGAAGGCAAGATCCCATCAAAGCTCTTCGATAGAGAGCTTGACGCTATATTCTTGAACCATAACCGGTTCCGGTTCGGGATTCCCAAAAACATGGGAAATTCCCCTGTTTCTGCTCTGGTTCTTGCGGACAACAATCTCGGAGGATGCATACCGGGAAGTATCGGTCAAATGGGGAAAACACTCAACGAGCTTATCCTCTCCAACGACAACTTAACCGGTTGTTTACCTCCTCAGATCGGAAACCTCAAGAAAGTGACGGTTTTCGACATCACTTCAAACCGTCTACAAGGTCCGTTACCATCTAGCGTTGGTAACATGAAGAGCCTAGAAGAGCTTCACGTGGCTAACAATGCCTTCACAGGAGTTATTCCTCCAAGTATCTGCCAGCTTTCTAACCTTGAGAACTTTACTTACTCTTCCAACTACTTCTCCGGTCGTCCTCCTATATGCGCAGCTAGTTTGTTAGCCGACATTGTGGTGAACGGTACCATGAACTGCATCACCGGTTTGGCTCGTCAAAGATCGGATAAACAGTGCTCATCTTTGCTTGCTCGCCCTGTGGATTGCAGTAAGTTTGGATGTTACAACATCTTCTCTCCACCACCACCGACGTTTAAGATGTCACCTGAAGTCCGGACACTTCCTCCACCGATTTACGTGTACTCATCGCCTCCTCCACCACCGTCGTCAAAGATGTCCCCTACCGTCAGAGCATACTCTCCCCCACCACCACCTTCGTCCAAGATGTCACCCTCTGTCAGAGCATATTCACCACCACCGCCTCCTTATTCCAAGATGTCACCTAGCGTTCGAGCTTACCCTCCTCCACCACCACCATCACCATCTCCCCCACCGCCTTACGTATACTCATCTCCTCCACCGCCCTATGTGTACTCATCTCCTCCTCCACCGCCGTATGTGTATTCATCCCCTCCTCCACCGCCTTACGTATACTCATCTCCTCCACCGCCTTACGTGTACTCATCTCCACCCCCGCCTTACGTATACTCATCTCCACCTCCGCCTCCTCCAAGTCCACCACCACCGTGTCCTGAATCATCTCCACCACCGCCTGTTGTATACTACGCACCCGTGACACAAAGCCCTCCACCACCATCACCGGTATACTATCCACCAGTAACACAAAGCCCTCCACCACCATCGCCAGTATACTACCCACCGGTGACAAACAGTCCACCACCACCATCACCGGTATACTATCCCCCAGTAACATACAGTccaccaccaccatcaccagtttactatccccaagtaacaccaagtcctccaccaccaTCGCCGCTATACTATCCCCCAGTAACACCAAGTCCACCACCACCATCACCAGTTTACTATCCCCCAGTAACACCAAGTCCTCCACCACCATCACCAGTTTACTATCCCCCAGTAACACCAAGTCCTCCACCACCATCACCAGTTTACTATCCATCGGAAACACAAAGTCCTCCACCACCTACTGAGTACTACTATTCACCAAGCCAGTCTCCGCCACCAACAAAAGCATGTAAAGAAGGCCATCCACCACAAGCAACACCAAGTTACGAACCACCTCCAGAATATTCATACTCATCATCACCACCACCACCATCTCCTACGTCCTACTTTCCACCGATGCCAAGCGTCTCATATGATGCATctcctcctcctcctccGTCTTACTACTAGTTTCAACCATTGAGTAAAAAAATGCATTGCCTTATGATTAACGAGACTACTCACAATTATATTCTTTTGGCTGCGAGACTTTAATTTGTGTGTTTTGTTGATTTAAAGAAAAAAAGACATTCCAGTTACTTTTTCTTGTAATAtttttttttcttttGGATATTATGTTCTTT


Protein sequences

Name Description Sequence
At.10625 translated coding region predicted by ESTScan from UniGene At.10625

MLFPPLRSLFLFTLLLSSVCFLQIKADHDDESDLGSDIKVDKRLKFENPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASLLADIVVNGTMNCITGLARQRSDKQCSSLLARPVDCSKFGCYNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPSETQSPPPPTEYYYSPSQSPPPTKACKEGHPPQATPSYEPPPEYSYSSSPPPPSPTSYFPPMPSVSYDASPPPPPSYY


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
48-331 SSF52058,LRR

NPKLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPP

Gene3D: G3DSA:3.80.10.10
50-337 G3DSA:3.80.10.10

KLRQAYIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASL

HMMPanther: PTHR24420:SF665
55-450 PTHR24420:SF665

YIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASLLADIVVNGTMNCITGLARQRSDKQCSSLLARPVDCSKFGCYNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMS

HMMPanther: PTHR24420
55-450 PTHR24420,FAMILY NOT NAMED

YIALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYCAPSPSYPKTRVVAGIDLNHADMAGYLASELGLLSDLALFHINSNRFCGEVPLTFNRMKLLYELDLSNNRFVGKFPKVVLSLPSLKFLDLRYNEFEGKIPSKLFDRELDAIFLNHNRFRFGIPKNMGNSPVSALVLADNNLGGCIPGSIGQMGKTLNELILSNDNLTGCLPPQIGNLKKVTVFDITSNRLQGPLPSSVGNMKSLEELHVANNAFTGVIPPSICQLSNLENFTYSSNYFSGRPPICAASLLADIVVNGTMNCITGLARQRSDKQCSSLLARPVDCSKFGCYNIFSPPPPTFKMSPEVRTLPPPIYVYSSPPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPPPYSKMS

HMMPfam: PF08263
IPR013210
57-89 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

ALQSWKKAIFSDPFNFTANWNGSDVCSYNGIYC

HMMPfam: PF00560
IPR001611
172-192 LRR_1
Leucine-rich repeat

SLKFLDLRYNEFEGKIPSKLF

FPrintScan: PR01217
383-395 PRICHEXTENSN,Proline rich extensin signature

PPPPTFKMSPEVR

FPrintScan: PR01217
406-427 PRICHEXTENSN,Proline rich extensin signature

SPPPPPSSKMSPTVRAYSPPPP

FPrintScan: PR01217
428-444 PRICHEXTENSN,Proline rich extensin signature

PSSKMSPSVRAYSPPPP

FPrintScan: PR01217
457-482 PRICHEXTENSN,Proline rich extensin signature

PPPPPPSPSPPPPYVYSSPPPPYVYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox