PRGDB00065921 (At.10804)

From PRG Wiki
Jump to: navigation, search
At.10804
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14334873 (AY035110)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative receptor protein kinase, ERECTA (At2g26330) mRNA, complete cds

DNA Sequence

GTTTCTTCTTCATGGAGACTTGAAAGCTTTTAAAGTATATCTAAAAACGCAGTCGTTTTAAGACTGTGTGTGAGAAATGGCTCTGTTTAGAGATATTGTTCTTCTTGGGTTTCTCTTCTGCTTGAGCTTAGTAGCTACTGTGACTTCAGAGGAGGGAGCAACGTTGCTGGAGATTAAGAAGTCATTCAAAGATGTGAACAATGTTCTTTATGACTGGACAACTTCACCTTCTTCGGATTATTGTGTCTGGAGAGGTGTGTCTTGTGAAAATGTCACCTTCAATGTTGTTGCTCTTAATTTGTCAGATTTGAATCTTGATGGAGAAATCTCACCTGCTATTGGAGATCTCAAGAGTCTCTTGTCAATTGATCTGCGAGGTAATCGCTTGTCTGGACAAATCCCTGATGAGATTGGTGACTGTTCTTCTTTGCAAAACTTAGACTTATCCTTCAATGAATTAAGTGGTGACATACCGTTTTCGATTTCGAAGTTGAAGCAACTTGAGCAGCTGATTCTGAAGAATAACCAATTGATAGGACCGATCCCTTCAACACTTTCACAGATTCCAAACCTGAAAATTCTGGACTTGGCACAGAATAAACTCAGTGGTGAGATACCAAGACTTATTTACTGGAATGAAGTTCTTCAGTATCTTGGGTTGCGAGGAAACAACTTAGTCGGTAACATTTCTCCAGATTTGTGTCAACTGACTGGTCTTTGGTATTTTGACGTAAGAAACAACAGTTTGACTGGTAGTATACCTGAGACGATAGGAAATTGCACTGCCTTCCAGGTTTTGGACTTGTCCTACAATCAGCTAACTGGTGAGATCCCTTTTGACATCGGCTTCCTGCAAGTTGCAACATTATCATTGCAAGGCAATCAACTCTCTGGGAAGATTCCATCAGTGATTGGTCTCATGCAAGCCCTTGCAGTCTTAGATCTAAGTGGCAACTTGTTGAGTGGATCTATTCCTCCGATTCTCGGAAATCTTACTTTCACCGAGAAATTGTATTTGCACAGTAACAAGCTGACTGGTTCAATTCCACCTGAGCTTGGAAACATGTCAAAACTCCATTACCTGGAACTCAATGATAATCATCTCACGGGTCATATACCACCAGAGCTTGGGAAGCTTACTGACTTGTTTGATCTGAATGTGGCCAACAATGATCTGGAAGGACCTATACCTGATCATCTGAGCTCTTGCACAAATCTAAACAGCTTAAATGTTCATGGGAACAAGTTTAGTGGCACTATACCCCGAGCATTTCAAAAGCTAGAAAGTATGACTTACCTTAATCTGTCCAGCAACAATATCAAAGGTCCAATCCCGGTTGAGCTATCTCGTATCGGTAACTTAGATACATTGGATCTTTCCAACAACAAGATAAATGGAATCATTCCTTCTTCCCTTGGTGATTTGGAGCATCTTCTCAAGATGAACTTGAGTAGAAATCATATAACTGGTGTAGTTCCAGGCGACTTTGGAAATCTAAGAAGCATCATGGAAATAGATCTTTCAAATAATGATATCTCTGGCCCAATTCCAGAAGAGCTTAACCAATTACAGAACATAATTTTGCTGAGACTGGAAAATAATAACCTGACTGGTAATGTTGGTTCATTAGCCAACTGTCTCAGTCTCACTGTATTGAATGTATCTCATAACAACCTCGTAGGTGATATCCCTAAGAACAATAACTTCTCAAGATTTTCACCAGACAGCTTCATTGGCAATCCTGGTCTTTGCGGTAGTTGGCTAAACTCACCGTGTCATGATTCTCGTCGAACTGTACGAGTGTCAATCTCTAGAGCAGCTATTCTTGGAATAGCTATTGGGGGACTTGTGATCCTTCTCATGGTCTTAATAGCAGCTTGCCGACCGCATAATCCTCCTCCTTTTCTTGATGGATCACTTGACAAACCAGTAACTTATTCGACACCGAAGCTCGTCATCCTTCATATGAACATGGCACTCCACGTTTACGAGGATATCATGAGAATGACAGAGAATCTAAGTGAGAAGTATATCATTGGGCACGGAGCATCAAGCACTGTATACAAATGTGTTTTGAAGAATTGTAAACCGGTTGCGATTAAGCGGCTTTACTCTCACAACCCACAGTCAATGAAACAGTTTGAAACAGAACTCGAGATGCTAAGTAGCATCAAGCACAGAAATCTTGTGAGCCTACAAGCTTATTCCCTCTCTCACTTGGGGAGTCTTCTGTTCTATGACTATTTGGAAAATGGTAGCCTCTGGGATCTTCTTCATGGCCCTACGAAGAAAAAGACTCTTGATTGGGACACACGGCTTAAGATAGCATATGGTGCAGCACAAGGTTTAGCTTATCTACACCATGACTGTAGTCCAAGGATCATTCACAGAGACGTGAAGTCGTCCAACATTCTCTTGGACAAAGACTTAGAGGCTCGTTTGACAGATTTTGGAATAGCGAAAAGCTTGTGTGTGTCAAAGTCACATACTTCAACTTACGTGATGGGCACGATAGGTTACATAGACCCCGAGTATGCTCGCACTTCACGGCTCACTGAGAAATCCGATGTCTACAGTTATGGAATAGTCCTTCTTGAGTTGTTAACCCGAAGGAAAGCCGTTGATGACGAATCCAATCTCCACCATCTGATAATGTCAAAGACGGGGAACAATGAAGTGATGGAAATGGCAGATCCAGACATCACATCGACGTGTAAAGATCTCGGTGTGGTGAAGAAAGTTTTCCAACTGGCACTCCTATGCACCAAAAGACAGCCGAATGATCGACCCACAATGCACCAAGTGACTCGTGTTCTCGGCAGTTTTATGCTATCGGAACAACCACCTGCTGCGACTGACACGTCAGCGACGCTGGCTGGTTCGTGCTACGTCGATGAGTATGCAAATCTCAAGACTCCTCATTCTGTCAATTGCTCTTCCATGAGTGCTTCTGATGCTCAACTGTTTCTTCGGTTTGGACAAGTTATTTCTCAGAACAGTGAGTAGTTTTTCGTTAGGAGGAGAATCTTTAAAACGGTATCTTTTCGTTGCGTTAAGCTGTTAGAAAAATTAATGTCTCATGTAAAGTATTATGCACTGCCTTATTATTATTAGACAAGTGTGTGGTGTGAATATGTCTTCAGACTGGCACTTAGACTTCCTATAAGTTCTTGCCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.10804 translated coding region predicted by ESTScan from UniGene At.10804

MALFRDIVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPPAATDTSATLAGSCYVDEYANLKTPHSVNCSSMSASDAQLFLRFGQVISQNSE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
7-924 PTHR24420,FAMILY NOT NAMED

IVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPP

HMMPanther: PTHR24420:SF825
7-924 PTHR24420:SF825

IVLLGFLFCLSLVATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGNPGLCGSWLNSPCHDSRRTVRVSISRAAILGIAIGGLVILLMVLIAACRPHNPPPFLDGSLDKPVTYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFMLSEQPP

superfamily: SSF52058
20-317 SSF52058,LRR

ATVTSEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSN

Gene3D: G3DSA:3.80.10.10
24-259 G3DSA:3.80.10.10

SEEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSCENVTFNVVALNLSDLNLDGEISPAIGDLKSLLSIDLRGNRLSGQIPDEIGDCSSLQNLDLSFNELSGDIPFSISKLKQLEQLILKNNQLIGPIPSTLSQIPNLKILDLAQNKLSGEIPRLIYWNEVLQYLGLRGNNLVGNISPDLCQLTGLWYFDVRNNSLTGSIPETIGNCTAFQVLDLSYNQLTGEIPFDIGFL

HMMPfam: PF08263
IPR013210
25-63 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EEGATLLEIKKSFKDVNNVLYDWTTSPSSDYCVWRGVSC

HMMPfam: PF00560
IPR001611
93-114 LRR_1
Leucine-rich repeat

SLLSIDLRGNRLSGQIPDEIGD

ProfileScan: PS51450
93-115 LRR,Leucine-rich repeat profile.

SLLSIDLRGNRLSGQIPDEIGDC

HMMPfam: PF13516
115-136 LRR_6,Leucine Rich repeat

CSSLQNLDLSFNELSGDIPFSI

ProfileScan: PS51450
117-140 LRR,Leucine-rich repeat profile.

SLQNLDLSFNELSGDIPFSISKLK

ProfileScan: PS51450
141-163 LRR,Leucine-rich repeat profile.

QLEQLILKNNQLIGPIPSTLSQI

ProfileScan: PS51450
165-187 LRR,Leucine-rich repeat profile.

NLKILDLAQNKLSGEIPRLIYWN

ProfileScan: PS51450
189-212 LRR,Leucine-rich repeat profile.

VLQYLGLRGNNLVGNISPDLCQLT

ProfileScan: PS51450
237-259 LRR,Leucine-rich repeat profile.

AFQVLDLSYNQLTGEIPFDIGFL

HMMPfam: PF00560
IPR001611
239-257 LRR_1
Leucine-rich repeat

QVLDLSYNQLTGEIPFDIG

superfamily: SSF52058
250-555 SSF52058,LRR

GEIPFDIGFLQVATLSLQGNQLSGKIPSVIGLMQALAVLDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRFSPDSFIGN

ProfileScan: PS51450
260-282 LRR,Leucine-rich repeat profile.

QVATLSLQGNQLSGKIPSVIGLM

ProfileScan: PS51450
284-306 LRR,Leucine-rich repeat profile.

ALAVLDLSGNLLSGSIPPILGNL

HMMPfam: PF00560
IPR001611
285-306 LRR_1
Leucine-rich repeat

LAVLDLSGNLLSGSIPPILGNL

Gene3D: G3DSA:3.80.10.10
288-547 G3DSA:3.80.10.10

LDLSGNLLSGSIPPILGNLTFTEKLYLHSNKLTGSIPPELGNMSKLHYLELNDNHLTGHIPPELGKLTDLFDLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNIKGPIPVELSRIGNLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDISGPIPEELNQLQNIILLRLENNNLTGNVGSLANCLSLTVLNVSHNNLVGDIPKNNNFSRF

ProfileScan: PS51450
308-330 LRR,Leucine-rich repeat profile.

FTEKLYLHSNKLTGSIPPELGNM

HMMPfam: PF00560
IPR001611
332-354 LRR_1
Leucine-rich repeat

KLHYLELNDNHLTGHIPPELGKL

ProfileScan: PS51450
332-355 LRR,Leucine-rich repeat profile.

KLHYLELNDNHLTGHIPPELGKLT

HMMPfam: PF13855
359-415 LRR_8,Leucine rich repeat

DLNVANNDLEGPIPDHLSSCTNLNSLNVHGNKFSGTIPRAFQKLESMTYLNLSSNNI

ProfileScan: PS51450
380-401 LRR,Leucine-rich repeat profile.

NLNSLNVHGNKFSGTIPRAFQK

ProfileScan: PS51450
404-425 LRR,Leucine-rich repeat profile.

SMTYLNLSSNNIKGPIPVELSR

ProfileScan: PS51450
428-449 LRR,Leucine-rich repeat profile.

NLDTLDLSNNKINGIIPSSLGD

HMMPfam: PF13855
428-487 LRR_8,Leucine rich repeat

NLDTLDLSNNKINGIIPSSLGDLEHLLKMNLSRNHITGVVPGDFGNLRSIMEIDLSNNDI

ProfileScan: PS51450
452-473 LRR,Leucine-rich repeat profile.

HLLKMNLSRNHITGVVPGDFGN

ProfileScan: PS51450
476-498 LRR,Leucine-rich repeat profile.

SIMEIDLSNNDISGPIPEELNQL

ProfileScan: PS51450
500-522 LRR,Leucine-rich repeat profile.

NIILLRLENNNLTGNVGSLANCL

HMMPfam: PF00560
IPR001611
523-541 LRR_1
Leucine-rich repeat

SLTVLNVSHNNLVGDIPKN

ProfileScan: PS51450
523-545 LRR,Leucine-rich repeat profile.

SLTVLNVSHNNLVGDIPKNNNFS

superfamily: SSF56112
IPR011009
620-914 Kinase_like
Protein kinase-like domain

TYSTPKLVILHMNMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVL

Gene3D: G3DSA:3.30.200.20
632-698 G3DSA:3.30.200.20

NMALHVYEDIMRMTENLSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSS

ProfileScan: PS50011
IPR000719
648-918 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LSEKYIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTRVLGSFM

HMMPfam: PF00069
IPR017442
652-911 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YIIGHGASSTVYKCVLKNCKPVAIKRLYSHNPQSMKQFETELEMLSSIKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVT

PatternScan: PS00107
IPR017441
654-676 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGASSTVYKCVLKNCKPVAIK

Gene3D: G3DSA:1.10.510.10
699-912 G3DSA:1.10.510.10

IKHRNLVSLQAYSLSHLGSLLFYDYLENGSLWDLLHGPTKKKTLDWDTRLKIAYGAAQGLAYLHHDCSPRIIHRDVKSSNILLDKDLEARLTDFGIAKSLCVSKSHTSTYVMGTIGYIDPEYARTSRLTEKSDVYSYGIVLLELLTRRKAVDDESNLHHLIMSKTGNNEVMEMADPDITSTCKDLGVVKKVFQLALLCTKRQPNDRPTMHQVTR

PatternScan: PS00108
IPR008271
769-781 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox