PRGDB00065923 (At.10895)

From PRG Wiki
Jump to: navigation, search
At.10895
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30699359 (NM_106530)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana curculin-like (mannose-binding) lectin family protein

DNA Sequence

ATCTCACTCTACTACTCAATCTCAGTAAACATAAAGAACACAACCATGCTTAGGTTTGATTACTTACTAATCACGGCACTTGCCATTTCAACTGTTTCGGTTGTCATGGCCCAAGTCCCTCCCGAGAAACAATTCAGAGTGCTCAACGAACCCGGCTACGCCCCATACATCACCGAGTACGACGCGAGTTACCGATTCCTCAACTCACCGAATCAGAATTTCTTCACAATTCCTTTCCAGCTCATGTTTTACAATACAACTCCTAGCGCCTACGTGTTAGCTCTCCGAGTCGGAACGAGGCGTGACATGAGTTTCACGCGTTGGATCTGGGACGCCAATCGCAACAACCCCGTCGGAGACAACTCCACACTCTCATTCGGCCGAAACGGAAACCTTGTGCTCGCTGAGTTAAACGGCCAAGTCAAGTGGCAGACTAACACAGCCAACAAAGGCGTCACCGGATTCCAAATCTTGCCCAATGGAAACATGGTGCTACACGACAAACATGGAAAATTCGTTTGGCAGAGTTTCGATCATCCCACCGATACACTCCTCGTCGGCCAATCCCTAAAAGTTAACGGAGTTAACAAACTCGTTAGCCGTACATCTGATATGAACGGCTCCGATGGTCCGTACAGCATGGTGTTGGACAACAAAGGCTTAACCATGTACGTTAACAAAACCGGTACGCCGTTAGTTTACGGGGGATGGACGGATCACGACTTCCGCGGTACCGTCACGTTCGCCGTTACAAGAGAGTTCGATAATTTAACGGAGCCGTCAGCTTACGAGCTTCTCTTAGAACCCGCACCACAACCCGCTACGAACCCGGGTAATAACCGCCGGTTACTCCAAGTTAGACCAATCGGAAGCGGAGGAGGAACTTTAAACTTAAACAAAATCAACTACAATGGAACGATATCGTATCTGAGACTTGGATCCGACGGTAGCCTCAAGGCCTTCTCGTATTTCCCTGCCGCGACGTATCTCGAATGGGAAGAGACTTTCGCTTTCTTCTCCAATTACTTCGTCCGTCAATGCGGTTTGCCGACGTTTTGCGGCGATTACGGTTACTGCGATCGAGGAATGTGCGTCGGGTGCCCTACACCGAAAGGTCTGTTAGCTTGGAGTGATAAATGCGCTCCACCTAAAACGACGCAGTTTTGCAGCGGAGGCAAGGGTAAAGCTGTCAATTATTACAAGATAGTCGGTGTTGAGCATTTTACTGGGCCGTATGTTAATGATGGACAAGGCCCAACTTCTGTGAACGATTGCAAGGCTAAGTGCGATCGTGATTGCAAGTGTTTGGGTTACTTCTACAAGGAGAAGGACAAGAAATGTTTGCTTGCTCCTCTTCTTGGTACACTTATCAAAGATGCCAACACTTCTTCCGTTGCTTACATCAAATATTAGCGAGATTTATAAACCGAAACCAACGTGAATTCTCATAGATTTAATGAATAATTGGTGTTGTTATAATGCTTCACCGTTTTTGTTTTCGTAGACTCGCGTATTATGCTCAGTCCTAGTCAAGTATGATATTATCAAAATAAAAATGGATGATATTGATGTTCTTCAGATTATCAAAATTGAAATTAATAGTCGATCATTATAATGCGTCCTTTATACAATATTCAATTAATGCTTTTGTTTTGTATAAATAACAATGAGACAACTCGATATTGTTGCA


Protein sequences

Name Description Sequence
At.10895 translated coding region predicted by ESTScan from UniGene At.10895

ISLYYSISVNIKNTTMLRFDYLLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLKAFSYFPAATYLEWEETFAFFSNYFVRQCGLPTFCGDYGYCDRGMCVGCPTPKGLLAWSDKCAPPKTTQFCSGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11795
1-468 FAMILY NOT NAMED,UNCHARACTERIZED

ISLYYSISVNIKNTTMLRFDYLLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLKAFSYFPAATYLEWEETFAFFSNYFVRQCGLPTFCGDYGYCDRGMCVGCPTPKGLLAWSDKCAPPKTTQFCSGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYI

HMMPanther: PTHR11795:SF49
1-468 SUBFAMILY NOT NAMED,PROTEIN KINASE-RELATED

ISLYYSISVNIKNTTMLRFDYLLITALAISTVSVVMAQVPPEKQFRVLNEPGYAPYITEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTDHDFRGTVTFAVTREFDNLTEPSAYELLLEPAPQPATNPGNNRRLLQVRPIGSGGGTLNLNKINYNGTISYLRLGSDGSLKAFSYFPAATYLEWEETFAFFSNYFVRQCGLPTFCGDYGYCDRGMCVGCPTPKGLLAWSDKCAPPKTTQFCSGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYI

ProfileScan: PS50927
IPR001480
58-178 BULB_LECTIN
Bulb-type lectin domain

TEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFD

HMMSmart: SM00108
IPR001480
58-180 Bulb-type mannose-specific lectin
Bulb-type lectin domain

TEYDASYRFLNSPNQNFFTIPFQLMFYNTTPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHP

superfamily: SSF51110
IPR001480
87-239 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

TPSAYVLALRVGTRRDMSFTRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGTPLVYGGWTD

Gene3D: G3DSA:2.90.10.10
IPR001480
106-230 no description
Bulb-type lectin domain

TRWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSDMNGSDGPYSMVLDNKGLTMYVNKTGT

HMMPfam: PF01453
IPR001480
107-204 B_lectin
Bulb-type lectin domain

RWIWDANRNNPVGDNSTLSFGRNGNLVLAELNGQVKWQTNTANKGVTGFQILPNGNMVLHDKHGKFVWQSFDHPTDTLLVGQSLKVNGVNKLVSRTSD

ProfileScan: PS50948
IPR003609
389-470 PAN
Apple-like

CSGGKGKAVNYYKIVGVEHFTGPYVNDGQGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLLAPLLGTLIKDANTSSVAYIKY

HMMPfam: PF08276
IPR013227
417-449 PAN_2
PAN-2 domain

QGPTSVNDCKAKCDRDCKCLGYFYKEKDKKCLL

Seg: seg
424-435 seg

DCKAKCDRDCKC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox