PRGDB00065924 (At.11057)

From PRG Wiki
Jump to: navigation, search
At.11057
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145336931 (NM_104854)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana BAN (BANYULS); oxidoreductase (BAN) mRNA, complete cds

DNA Sequence

ATAACAACTAAATCTCTATCTCTGTAATTTCAAAAGTACAATCATGGACCAGACTCTTACACACACCGGATCGAAGAAGGCTTGTGTCATTGGTGGCACGGGAAACTTAGCCTCTATTCTCATCAAGCATTTGCTTCAAAGTGGCTACAAAGTTAACACTACAGTTAGAGATCCAGAAAACGAGAAGAAAATAGCTCACCTTAGGAAACTTCAAGAGCTTGGCGACCTGAAGATCTTCAAGGCAGATTTGACTGATGAAGACAGTTTCGAATCCTCATTCTCCGGCTGTGAATACATCTTCCATGTCGCAACTCCGATCAACTTTAAATCCGAAGATCCCGAGAAAGACATGATCAAGCCGGCGATACAAGGAGTGATCAATGTGTTGAAATCTTGCTTAAAATCGAAATCAGTCAAGCGTGTGATCTACACATCTTCAGCTGCTGCTGTTTCCATCAACAATCTTTCTGGAACCGGAATCGTGATGAACGAAGAAAACTGGACTGACGTTGAATTTCTCACAGAGGAGAAGCCTTTTAACTGGGGTTACCCAATCTCGAAGGTGTTAGCAGAAAAGACAGCTTGGGAATTTGCAAAAGAGAATAAGATCAATCTCGTTACCGTGATTCCGGCACTTATAGCCGGAAACTCTCTCCTCTCCGATCCTCCGAGTAGCTTATCTCTCTCGATGTCTTTCATCACCGGGAAAGAAATGCATGTGACCGGTCTCAAGGAAATGCAGAAGCTATCTGGCTCGATCTCGTTCGTCCACGTAGACGATTTAGCTCGTGCCCATTTGTTTCTTGCGGAGAAAGAAACTGCTTCTGGTCGCTACATTTGCTGTGCTTACAACACAAGTGTTCCAGAGATTGCGGATTTTCTCATACAGAGATATCCTAAGTACAATGTGTTGTCAGAATTCGAAGAGGGCTTGTCGATTCCGAAATTGACACTATCTTCGCAAAAACTTATCAATGAAGGCTTTCGATTCGAATATGGGATCAATGAGATGTATGATCAAATGATAGAGTACTTCGAGTCAAAAGGATTGATCAAAGCTAAATAAACTTGACTTTTATAATGTCAAAATGGATTCAAAGAGTATATGAGTCTTTGGTCTCATTCTCATTCTATAAAATGGTATTGAATAATTATGTATTATATGTTGGTTGATTTAATGTCTTTTGATACATAAATATTACATACTTTTGAAATGAACTTGTG


Protein sequences

Name Description Sequence
At.11057 translated coding region predicted by ESTScan from UniGene At.11057

MDQTLTHTGSKKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAYNTSVPEIADFLIQRYPKYNVLSEFEEGLSIPKLTLSSQKLINEGFRFEYGINEMYDQMIEYFESKGLIKAK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366:SF9
1-340 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

MDQTLTHTGSKKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAYNTSVPEIADFLIQRYPKYNVLSEFEEGLSIPKLTLSSQKLINEGFRFEYGINEMYDQMIEYFESKGLIKAK

HMMPanther: PTHR10366
1-340 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MDQTLTHTGSKKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAYNTSVPEIADFLIQRYPKYNVLSEFEEGLSIPKLTLSSQKLINEGFRFEYGINEMYDQMIEYFESKGLIKAK

Gene3D: G3DSA:3.40.50.720
IPR016040
10-283 NAD(P)-bd
NAD(P)-binding domain

SKKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAYNTSVPEIADFLIQR

superfamily: SSF51735
11-333 NAD(P)-bd

KKACVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRYICCAYNTSVPEIADFLIQRYPKYNVLSEFEEGLSIPKLTLSSQKLINEGFRFEYGINEMYDQMIEYFES

HMMPfam: PF01370
IPR001509
14-264 Epimerase
NAD-dependent epimerase/dehydratase

CVIGGTGNLASILIKHLLQSGYKVNTTVRDPENEKKIAHLRKLQELGDLKIFKADLTDEDSFESSFSGCEYIFHVATPINFKSEDPEKDMIKPAIQGVINVLKSCLKSKSVKRVIYTSSAAAVSINNLSGTGIVMNEENWTDVEFLTEEKPFNWGYPISKVLAEKTAWEFAKENKINLVTVIPALIAGNSLLSDPPSSLSLSMSFITGKEMHVTGLKEMQKLSGSISFVHVDDLARAHLFLAEKETASGRY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox