PRGDB00065926 (At.11162)

From PRG Wiki
Jump to: navigation, search
At.11162
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30697157 (NM_105192)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT1G65190) mRNA, complete cds

DNA Sequence

GCAAACTCGTTATGGAGTTCTTGAAAATACTCTCTGCTCATTTGATTTAAAACTAAAGTCTTTCTTTTATaaaaaaaaaaaacagaaaaaaaaacagtttaggtttagagatgggttggttgtggaggaagaagaaaaagaataagaagctagaattggagagaggagccaagttgttagaagagcTCATCGAATGTTGCGATGGCAAATCCAATCCCATCAAATTCTTCTCTGCTGATGAGATCCGCAAAGCCACCAACATTTTCAGCCACTCTAATCTTGTTCATCAGGAAGAATTTTACTGCCAATGGTATTCAGGTAAGAACGAGAACCATCCCATGATACTCATCAGGAAAGATTCTAATGTGAGGGGAGGAGATCTTGTGTGCCGCAACATAGCAGTTTCATCGATGGTGAGTGGTCACAAGAACTTTATGAAATTGGTTGGATGTTGTCTTGAGTTGAAATATCCAGTCACGGTCTATCATGGTGTTAAGAAACATTATGGATTAGAAATAGATGAGAAGCCGTGGAAAAGAAGAATGAAGATAGCAGAAGATATCGCCACTGCTTTAGCTTACCTTCACACTGCCTTCCCTAGGCCCCTCGTATATATGATTTTGTCTCATCGGAATATCTTATTGGATGAAGATGGTGTCGCGAAGCTGACTGATTTCTCTCACTGCGTCTCAATCCCAGAAGGAGAAACATTTGTCCGGGTTGAGGCAGAAGATGGATTCTATAGTTACTTTGCTGATAATTACGTTAACAGTGTTGTAGTCTCAGAGAAAACAGATGTCTTTGCCTTTGGAATCTTTATGGGTCTAACGCTTCTATTAGGATACAAAAGCTATTTCGAGCATTATCGAGGagaagaaaaagaaagtgaagaagaagaccctgaagaTACTGATGAATTAGATTATTTTAACAAGAAAAGACATGCTCGATATTGGCTGTCAAAATTAAAGAAAGACCGACCAATGGAAGAGATTGCAGATCGAAAGATGATAAAAAATATGGGTCAAATCTTAGAACAAGAGCTCTTTCAAATGAAAGCTTTCCGGATGCTCTCACTGAGATGCATGGGTCCTAGTGAAGAAGTTCCAACGATGGTGGAGGTGGCCAAAGAACTAAAGAAGATCCAAAAATCTCTTAATAAAGATTCTTATCGAGGagaagaagaagaagaagaaagtgaagaTGAATTTAACGACTCTTCTTCTCTTTCTTCAGGTCAAACCCAATTCGACTCTGCCCAAGACATTTCTTCCACAGTGGTCCTCTCAAACCAAACTTAAACACAAAGGCATTGCTACCAAGTATTGCCTGCCAGGTATTTCGTGAAATGTTTCAATGGGTTATGTTGAGCTGGTTTCGTTTTTTCAGGAAAAATCGAACAATGTGCTGAAAATAAGTTGAATTCATGTTCGTATTAAAACATTATCAAGTTTCATTTTTGTTGTTGTATTTATAAATAGTGCTACGTTACTTTTGATTCATTATATTGTCCCTTAAGAGTTTGTGTATGTGTGTTTGGGTTTTGATCGATCCGTCTGTTTTTGTTAATGTAATAATTTTATCAAGAGATGTTATGATATATGTGAATCTTGTATTGATGATTGTCTACTCGTGTATTATAAGGGAAAGTCTCCCAAGTCAATAACAATTCTAAAGTTTACATT


Protein sequences

Name Description Sequence
At.11162 translated coding region predicted by ESTScan from UniGene At.11162

MGWLWRKKKKNKKLELERGAKLLEELIECCDGKSNPIKFFSADEIRKATNIFSHSNLVHQEEFYCQWYSGKNENHPMILIRKDSNVRGGDLVCRNIAVSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELFQMKAFRMLSLRCMGPSEEVPTMVEVAKELKKIQKSLNKDSYRGEEEEEESEDEFNDSSSLSSGQTQFDSAQDISSTVVLSNQT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-313 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MGWLWRKKKKNKKLELERGAKLLEELIECCDGKSNPIKFFSADEIRKATNIFSHSNLVHQEEFYCQWYSGKNENHPMILIRKDSNVRGGDLVCRNIAVSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELF

HMMPanther: PTHR24420
1-392 PTHR24420,FAMILY NOT NAMED

MGWLWRKKKKNKKLELERGAKLLEELIECCDGKSNPIKFFSADEIRKATNIFSHSNLVHQEEFYCQWYSGKNENHPMILIRKDSNVRGGDLVCRNIAVSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELFQMKAFRMLSLRCMGPSEEVPTMVEVAKELKKIQKSLNKDSYRGEEEEEESEDEFNDSSSLSSGQTQFDSAQDISSTVVL

HMMPanther: PTHR24420:SF733
1-392 PTHR24420:SF733

MGWLWRKKKKNKKLELERGAKLLEELIECCDGKSNPIKFFSADEIRKATNIFSHSNLVHQEEFYCQWYSGKNENHPMILIRKDSNVRGGDLVCRNIAVSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELFQMKAFRMLSLRCMGPSEEVPTMVEVAKELKKIQKSLNKDSYRGEEEEEESEDEFNDSSSLSSGQTQFDSAQDISSTVVL

superfamily: SSF56112
IPR011009
41-340 Kinase_like
Protein kinase-like domain

SADEIRKATNIFSHSNLVHQEEFYCQWYSGKNENHPMILIRKDSNVRGGDLVCRNIAVSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELFQMKAFRMLSLRCMGPSEEVPTMVEVAK

HMMPfam: PF07714
IPR001245
98-248 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VSSMVSGHKNFMKLVGCCLELKYPVTVYHGVKKHYGLEIDEKPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSY

Gene3D: G3DSA:1.10.510.10
139-368 G3DSA:1.10.510.10

KPWKRRMKIAEDIATALAYLHTAFPRPLVYMILSHRNILLDEDGVAKLTDFSHCVSIPEGETFVRVEAEDGFYSYFADNYVNSVVVSEKTDVFAFGIFMGLTLLLGYKSYFEHYRGEEKESEEEDPEDTDELDYFNKKRHARYWLSKLKKDRPMEEIADRKMIKNMGQILEQELFQMKAFRMLSLRCMGPSEEVPTMVEVAKELKKIQKSLNKDSYRGEEEEEESEDEFN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox