PRGDB00065927 (At.11347)

From PRG Wiki
Jump to: navigation, search
At.11347
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145335676 (NM_101266)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana VIK (VH1-INTERACTING KINASE); ATP binding

DNA Sequence

AAGTTAACGGCGATTATCTTCGTTCACACAAGCAACACAAAAGAGAAAACATGAATCAtctctctctccctctctcCGGTTCCACAGTAAAGAATTGATTCCTCAATCTCACGCGGAAGCAAAATCCAAATTCTAAAATTCTAAGAAACCACTCTAATCACATCGCTCTATCGATCAAAATCGAAACCCTTATTCAAAAATCTCTTATTTTTTCCATTTTTCTCTCAATCATCTGAATCGGTTTTGAGATGAGCTCCGATTCACCGGCGGCTGGAGACGGTGGCGAACAAGCCGCTGCGGGAACAAGCGTGCCTTCACCTTCATACGACAAACAAAAGGAGAAGGCACGTGTGAGTAGAACATCTCTGATACTATGGCACGCGCACCAAAACGACGCAGCTGCAGTTCGGAAACTCTTGGAGGAAGATCCGACTTTGGTTCACGCTAGAGACTATGACAAACGAACGCCTCTCCACGTGGCGTCGCTTCATGGATGGATCGATGTTGTTAAATGTCTGCTTGAGTTTGGTGCTGATGTCAATGCTCAGGATAGGTGGAAGAACACGCCACTGGCTGATGCAGAAGGAGCTAGGAAGCAGAAAATGATTGAACTGCTGAAATCTCATGGTGGTTTGTCTTATGGTCAAAACGGAAGTCACTTTGAACCAAAGCCTGTGCCACCACCAATTCCAAAGAAATGTGACTGGGAAATTGAACCTGCTGAGCTGGATTTTTCAAATGCTGCAATGATTGGAAAGGGTTCATTTGGTGAGATTGTGAAAGCCTATTGGAGAGGAACACCGGTAGCTGTGAAACGTATTCTTCCTTCTCTTTCAGATGATAGACTGGTTATTCAGGACTTCAGGCATGAGGTTGATTTGCTAGTTAAGCTTCGCCATCCAAATATAGTCCAATTCTTAGGAGCGGTAACCGAAAGAAAGCCCCTTATGTTAATCACTGAGTACTTACGCGGGGGAGATCTTCATCAATACCTCAAGGAGAAGGGCGGTCTTACTCCAACAACTGCTGTCAACTTTGCTTTGGATATCGCGAGAGGAATGACATATCTTCACAATGAACCTAATGTTATCATTCACCGAGATCTTAAACCAAGGAACGTTCTTCTGGTTAATTCTAGTGCAGACCACTTGAAAGTTGGAGACTTTGGACTTAGTAAGCTCATAAAAGTTCAAAACTCTCATGATGTCTACAAAATGACTGGAGAAACAGGAAGCTATCGTTATATGGCTCCTGAAGTATTCAAGCATAGAAGATATGACAAGAAAGTCGATGTCTTCTCCTTTGCAATGATACTTTACGAGATGCTTGAAGGAGAGCCACCATTTGCGAACCATGAGCCATATGAAGCAGCCAAACATGTATCTGATGGACATAGACCTACATTCCGTTCCAAAGGATGCACACCAGATCTAAGAGAGTTAATTGTGAAATGCTGGGACGCAGACATGAACCAGAGACCGTCGTTTCTGGACATTCTCAAGAGACTTGAAAAGATCAAGGAAACTCTACCATCAGATCACCATTGGGGCTTATTCACTTCATAATACACAAAATCCATTATTTAAGCACAAAAACAACCAGAAACAAGAAAGTATCATTCTCTGTTTGCCTTATTAATCTCTGtttcatttcttttgtaaagattgtttctttttcatcttttcatttgctttAAAAGAGTGTGAGATAGAAAGCTTTTATTGTTGTTACATGGATTGGATTGAGTTTGCAGGTTAATGAGAAGTTCATATCATATCAGACAGGATAAAATGTCTGTTTCCGAA


Protein sequences

Name Description Sequence
At.11347 translated coding region predicted by ESTScan from UniGene At.11347

MSSDSPAAGDGGEQAAAGTSVPSPSYDKQKEKARVSRTSLILWHAHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHGGLSYGQNGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDHHWGLFTS

Domains

Domain Start-End Description Sequence

HMMPIR: PIRSF000654
IPR016253
1-438 Integrin-linked_kinase
Integrin-linked protein kinase

MSSDSPAAGDGGEQAAAGTSVPSPSYDKQKEKARVSRTSLILWHAHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHGGLSYGQNGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDHHWGLFTS

superfamily: SSF48403
IPR020683
35-127 ANK
Ankyrin repeat-containing domain

VSRTSLILWHAHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHG

ProfileScan: PS50297
IPR020683
36-127 ANK_REP_REGION
Ankyrin repeat-containing domain

SRTSLILWHAHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHG

Gene3D: G3DSA:1.25.40.20
IPR020683
40-128 ANK
Ankyrin repeat-containing domain

LILWHAHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHGG

HMMPfam: PF12796
IPR020683
45-127 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

AHQNDAAAVRKLLEEDPTLVHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHG

HMMPanther: PTHR23257
64-433 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHGGLSYGQNGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDHHW

HMMPanther: PTHR23257:SF89
64-433 PTHR23257:SF89,ANKYRIN-KINASE

VHARDYDKRTPLHVASLHGWIDVVKCLLEFGADVNAQDRWKNTPLADAEGARKQKMIELLKSHGGLSYGQNGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDHHW

HMMSmart: SM00248
IPR002110
70-99 ANK
Ankyrin repeat

DKRTPLHVASLHGWIDVVKCLLEFGADVNA

ProfileScan: PS50088
IPR002110
70-102 ANK_REPEAT
Ankyrin repeat

DKRTPLHVASLHGWIDVVKCLLEFGADVNAQDR

superfamily: SSF56112
IPR011009
134-433 Kinase_like
Protein kinase-like domain

NGSHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETLPSDHHW

Gene3D: G3DSA:3.30.200.20
136-225 G3DSA:3.30.200.20

SHFEPKPVPPPIPKKCDWEIEPAELDFSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLG

HMMSmart: SM00220
IPR002290
162-427 S_TKc
Serine/threonine-protein kinase domain

FSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETL

ProfileScan: PS50011
IPR000719
162-427 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNAAMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLEKIKETL

HMMPfam: PF07714
IPR001245
166-420 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

AMIGKGSFGEIVKAYWRGTPVAVKRILPSLSDDRLVIQDFRHEVDLLVKLRHPNIVQFLGAVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRL

PatternScan: PS00107
IPR017441
168-189 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGSFGEIVKAYWRGTPVAVK

Gene3D: G3DSA:1.10.510.10
226-421 G3DSA:1.10.510.10

AVTERKPLMLITEYLRGGDLHQYLKEKGGLTPTTAVNFALDIARGMTYLHNEPNVIIHRDLKPRNVLLVNSSADHLKVGDFGLSKLIKVQNSHDVYKMTGETGSYRYMAPEVFKHRRYDKKVDVFSFAMILYEMLEGEPPFANHEPYEAAKHVSDGHRPTFRSKGCTPDLRELIVKCWDADMNQRPSFLDILKRLE

FPrintScan: PR00109
IPR001245
237-250 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYLRGGDLHQYLK

FPrintScan: PR00109
IPR001245
275-293 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HNEPNVIIHRDLKPRNVLL

PatternScan: PS00108
IPR008271
281-293 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKPRNVLL

FPrintScan: PR00109
IPR001245
391-413 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CTPDLRELIVKCWDADMNQRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox