PRGDB00065928 (At.11393)

From PRG Wiki
Jump to: navigation, search
At.11393
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145336393 (NM_103144)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana SERK2 (SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 2); kinase (SERK2) mRNA, complete cds

DNA Sequence

ACTTTTGTAGTGACTAGTGAGTAGAGTAGGCTTTTagagagagagagagagagaCGGCTGTTGAAAGATAACCACAGAACACAAAAACTCATTCATTAAGAATGAGAAAGAAAGTCCCAAAAACCTTTTTTGCTCTGAAAAAGCAACGCAAAGTTTTGAAAAATCTCACACCTTTTTCACTTCTCTGTTTGTAGCTGTTACCACTTGTGTTTCCCCTTTGGCATTTTTCTCGGTTGTCATTAATGAGAGTAAAATCATCATCAAGTGTAAACttctctctctctttctctatctctatctcaaagctctcAACTTTGGAGAGATCATGGTTTGTGTTTGATTTCTCAAGtttttttttttttACCCTCTTGGAGGATCTGGGAGGAGAAATTTGCttttttttGGTAAATGGGGAGAAAAAAGTTTGAAGCTTTTGGTTTTGTCTGCTTAATCTCACTGCTTCTTCTGTTTAATTCGTTATGGCTTGCCTCTTCTAACATGGAAGGTGATGCACTGCACAGTTTGAGAGCTAATCTAGTTGATCCAAATAATGTCTTGCAAAGCTGGGATCCTACGCTTGTTAATCCGTGTACTTGGTTTCACGTAACGTGTAACAACGAGAACAGTGTTATAAGAGTCGATCTTGGGAATGCAGACTTGTCTGGTCAGTTGGTTCCTCAGCTAGGTCAGCTCAAGAACTTGCAGTACTTGGAGCTTTATAGTAATAACATAACCGGGCCGGTTCCAAGCGATCTTGGGAATCTGACAAACTTAGTGAGCTTGGATCTTTACTTGAACAGCTTCACTGGTCCAATTCCAGATTCTCTAGGAAAGCTATTCAAGCTTCGCTTTCTTCGGCTCAACAATAACAGTCTCACCGGACCAATTCCCATGTCATTGACTAATATCATGACCCTTCAAGTTTTGGATCTGTCGAACAACCGATTATCCGGATCTGTTCCTGATAATGGTTCCTTCTCGCTCTTCACTCCCATCAGTTTTGCTAACAACTTGGATCTATGCGGCCCAGTTACTAGCCGTCCTTGTCCTGGATCTCCCCCGTTTTCTCCTCCACCACCTTTTATACCACCTCCCATAGTTCCTACACCAGGTGGGTATAGTGCTACTGGAGCCATTGCGGGAGGAgttgctgctggtgctgctttactatttgctgcccctgctttagcttttgcttGGTGGCGTAGAAGAAAACCTCAAGAATTCTTCTTTGATGTTCCTGCCGAAGAGGACCCTGAGGTTCACTTGGGGCAGCTTAAGCGGTTCTCTCTACGGGAACTTCAAGTAGCAACTGATAGCTTCAGCAACAAGAACATTTTGGGCCGAGGTGGGTTCGGAAAAGTCTACAAAGGCCGTCTTGCTGATGGAACACTTGTTGCAGTCAAACGGCTTAAAGAAGAGCGAACCCCAGGTGGCGAGCTCCAGTTTCAGACAGAAGTGGAGATGATAAGCATGGCCGTTCACAGAAATCTCCTCAGGCTACGCGGTTTCTGTATGACCCCTACCGAGAGATTGCTTGTTTATCCTTACATGGCTAATGGAAGTGTCGCTTCCTGTTTGAGAGAACGTCCACCATCACAGTTGCCTCTAGCCTGGTCAATAAGACAGCAAATCGCGCTAGGATCAGCGAGGGGTTTGTCTTATCTTCATGATCATTGCGACCCCAAAATTATTCACCGTGATGTGAAAGCTGCTAATATTCTGTTGGACGAGGAATTTGAGGCGGTGGTAGGTGATTTCGGGTTAGCTAGACTTATGGACTATAAAGATACTCATGTCACAACGGCTGTGCGTGGGACTATTGGACACATTGCTCCTGAGTATCTCTCAACTGGAAAATCTTCAGAGAAAACTGATGTTTTTGGCTACGGGATCATGCTTTTGGAACTGATTACAGGTCAGAGAGCTTTTGATCTTGCAAGACTGGCGAATGACGATGACGTTATGCTCCTAGATTGGGTGAAAGGGCTTTTGAAGGAGAAGAAGCTGGAGATGCTTGTGGATCCTGACCTGCAAAGCAATTACACAGAAGCAGAAGTAGAACAGCTCATACAAGTGGCTCTTCTCTGCACACAGAGCTCACCTATGGAACGACCTAAGATGTCTGAGGTTGTTCGAATGCTTGAAGGTGACGGTTTAGCGGAGAAATGGGACGAGTGGCAGAAAGTGGAAGTTCTCAGGCAAGAAGTGGAGCTCTCTTCTCACCCCACCTCTGACTGGATCCTTGATTCGACTGATAATCTTCATGCTATGGAGTTGTCTGGTCCAAGATAAACGACATTGTAATTTGCCTAACAGAAAAGAGAAAGAACAGAGAAATATTAAGAGAATCACTTCTCTGTATTCTTTATTTCTTTGGTAGAAAAATAATGTAGTCTCTAATCAAATCTTATTCCATCTATCAGCATTCTTCATTCATTTCTTGTG


Protein sequences

Name Description Sequence
At.11393 translated coding region predicted by ESTScan from UniGene At.11393

MEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCPGSPPFSPPPPFIPPPIVPTPGGYSATGAIAGGVAAGAALLFAAPALAFAWWRRRKPQEFFFDVPAEEDPEVHLGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKWDEWQKVEVLRQEVELSSHPTSDWILDSTDNLHAMELSGPR

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-156 L domain-like,LRR

MEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPD

HMMPanther: PTHR24420:SF351
1-594 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCPGSPPFSPPPPFIPPPIVPTPGGYSATGAIAGGVAAGAALLFAAPALAFAWWRRRKPQEFFFDVPAEEDPEVHLGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKWDEWQKVEVLRQEVELSSHPTSDWILDSTDNLHAMEL

HMMPanther: PTHR24420
1-594 FAMILY NOT NAMED,FAMILY NOT NAMED

MEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCPGSPPFSPPPPFIPPPIVPTPGGYSATGAIAGGVAAGAALLFAAPALAFAWWRRRKPQEFFFDVPAEEDPEVHLGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKWDEWQKVEVLRQEVELSSHPTSDWILDSTDNLHAMEL

HMMPfam: PF08263
IPR013210
2-39 LRRNT_2
Leucine-rich repeat-containing N-terminal domain,

EGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCN

Gene3D: G3DSA:3.80.10.10
3-169 no description

GDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFA

HMMPfam: PF00560
IPR001611
67-89 LRR_1
Leucine-rich repeat

NLQYLELYSNNITGPVPSDLGNL

Seg: seg
109-126 seg

SLGKLFKLRFLRLNNNSL

HMMPfam: PF00560
IPR001611
115-135 LRR_1
Leucine-rich repeat

KLRFLRLNNNSLTGPIPMSLT

HMMPfam: PF00560
IPR001611
140-157 LRR_1
Leucine-rich repeat

LQVLDLSNNRLSGSVPDN

Seg: seg
182-205 seg

PCPGSPPFSPPPPFIPPPIVPTPG

Gene3D: G3DSA:2.60.120.200
IPR013320
188-293 no description
Concanavalin A-like lectin/glucanase, subgroup

PFSPPPPFIPPPIVPTPGGYSATGAIAGGVAAGAALLFAAPALAFAWWRRRKPQEFFFDVPAEEDPEVHLGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGR

Seg: seg
209-233 seg

ATGAIAGGVAAGAALLFAAPALAFA

superfamily: SSF56112
IPR011009
245-557 Protein kinase-like (PK-like)
Protein kinase-like domain

FDVPAEEDPEVHLGQLKRFSLRELQVATDSFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEK

ProfileScan: PS50011
IPR000719
275-562 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKWDEWQ

HMMSmart: SM00220
IPR002290
275-549 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRML

HMMSmart: SM00219
IPR020635
275-549 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRML

HMMPfam: PF07714
IPR001245
278-549 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KNILGRGGFGKVYKGRLADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRML

PatternScan: PS00107
IPR017441
281-303 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGKVYKGRLADGTLVAVK

Gene3D: G3DSA:3.30.200.20
294-352 no description

LADGTLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYM

Gene3D: G3DSA:1.10.510.10
353-549 no description

ANGSVASCLRERPPSQLPLAWSIRQQIALGSARGLSYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLARLMDYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRML

PatternScan: PS00108
IPR008271
398-410 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKAANILL

Seg: seg
496-507 seg

KGLLKEKKLEML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox