PRGDB00065929 (At.11547)

From PRG Wiki
Jump to: navigation, search
At.11547
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14334805 (AY035076)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative protein kinase (At1g68690) mRNA, complete cds

DNA Sequence

AACGTAGCATTGAAGCATTTTCTCAGAGAGTAGAGAAGACGCTGCGAAACTCAGAAAATTAAATTTTCAAGCTCGGAAGGAAACTCTGATTCATTATTACAGATTCGAAGTTTCAGAGAAGAAGGGACAAGACAAAGTTTAACTGCTTACTTGTTGTGTTTTTGCTCTCTGGTCTTCAATTGCTGAAGTTTTATAACGGAGATGTTTCAGTTATGATCTTACAGATCTGAGGTTATTGCATATCCACTCAAATTGGGTAATCTCAGTGATCTGGAATTTTGGTGGAAGCAAAGCAAAATTTGTGttttttttGCTCGGCCGATCTGGGTTTGATCTATTACATCGTCTTCTCTGCTTTGTCTGAAATTAGCTGTGTTGTGATTTCGAAAGTTTGCTACTTCTTCACGTTTAGTGTTCTTAGTTGGTAAAGTTTGGTACTTTCAGGATACTGTCATACTCAAAGTCTGGGACTTTTAGGTGTTTTTGATTGTTCATTTGGTGATTGATCATCGTCTCTGATCGTTACTTGGAGGAAAGATTCCAAATTTTTGAATGAGAAGTTGATTTGTTGATCGGAATTGAGATGGCAACAACACCGGTTCAACCTCCGGTTTCAAATTCTCCACCGGTGACTTCGCCGCCGCCGCCACTGAATAATGCTACTTCTCCGGCTACACCACCACCAGTAACATCGCCGCTACCTCCGTCAGCACCTCCACCAAATAGAGctcctcctcctcctcctccGGTGACTACCTCACCACCACCAGTTGCTAATGGAGCTCCTCCTCCTCCACTGCCAAAACCACCTGAGAGCTCTTCTCCGCCACCACAACCAGTGATCCCTTCACCTCCTCCTTCAACTTCGCCGCCACCACAACCAGTAATCCCTTCACCTCCTCCTTCAGCATCTCCACCACCTGCATTAGTCCCACCACTACCTTCTTCTCCTCCACCTCCTGCATCTGTTCCTCCTCCTCGGCCATCGCCTTCACCACCAATCTTAGTACGTTCTCCTCCGCCCTCAGTGCGTCCAATTCAAtctcctcctcctccaccttcagaccgtcccactcaatctcctcctcctccttctcctccttcaccaccttcagagcgtcctactcaatctcctccttcgccaccttcagaacgtcctactcaatctcctccgcctccttctcctccttcaccgccttcagaccgtccctctcaatctcctcctcCACCACCAGAGGATACTAAACCCCAACCTCCCAGGAGAAGTCCAAATTCTCCACCACCAACATTCTCTTCTCCTCCACGTTCTCCTCCTGAAATACTTGTCCCAGGTTCTAACAATCCATCTCAAAACAACCCTACTCTTAGACCTCCTCTTGATGCTCCAAATTCTACTAATAATAGTGGAATTGGTACTGGTGCTGTTGTTGGTATCAGTGTAGCAGTAGCACTTGTGGTCTTCACTCTTTTTGGTATCTTTGTCTGGTGCTTGAGGAAACGAGAAAAACGCCTTTCAGCTGTTAGTGGTGGCGATGTTACACCATCACCAATGAGCTCTACCGCAAGATCAGATTCAGCATTTTTTAGGATGCAGTCATCTGCACCTGTTGGAGCAAGCAAGCGTTCGGGCAGTTATCAATCACAATCCGGTGGCTTAGGCAATTCGAAAGCATTGTTTTCCTATGAAGAACTTGTGAAGGCAACAAATGGTTTTTCACAAGAAAATCTATTAGGTGAAGGTGGATTTGGTTGTGTATATAAAGGGATATTACCTGATGGGAGAGTAGTTGCTGTGAAACAACTAAAGATCGGTGGAGGACAAGGTGACAGGGAGTTTAAAGCCGAAGTTGAAACTCTTAGCAGAATTCATCACCGCCATTTGGTTTCAATCGTGGGACATTGTATCTCTGGTGACCGTAGATTGCTTATCTATGATTATGTTTCTAACAATGACCTTTACTTCCACCTTCATGGAGAAAAATCTGTTCTAGACTGGGCAACACGTGTTAAAATTGCGGCTGGGGCAGCTCGTGGACTAGCTTATCTTCATGAAGATTGTCATCCGCGTATCATTCACAGGGACATCAAGTCGTCTAACATTCTTTTAGAGGACAACTTTGATGCTCGGGTTTCTGACTTTGGCCTTGCAAGATTAGCTCTTGATTGTAACACTCATATCACCACACGGGTCATCGGAACATTTGGCTATATGGCTCCTGAATATGCATCAAGTGGAAAATTAACAGAGAAATCAGATGTATTCTCCTTTGGGGTTGTTCTGCTGGAGTTAATCACTGGACGTAAACCGGTGGATACATCGCAACCACTGGGAGATGAGAGCCTTGTTGAATGGGCCCGGCCTTTGATAAGTCATGCCATAGAAACCGAGGAATTTGATTCTTTAGCAGATCCTAAGCTTGGAGGAAACTATGTAGAATCTGAAATGTTTAGAATGATTGAAGCAGCAGGAGCCTGCGTGCGGCATTTAGCTACCAAGAGACCTCGGATGGGACAAATTGTGAGAGCTTTTGAAAGTTTAGCTGCGGAAGACCTTACTAACGGAATGAGACTAGGCGAAAGCGAGGTCTTTAACTCAGCTCAACAGTCAGCAGAGATCAGATTGTTTAGAAGAATGGCATTTGGTAGCCAAAATTACAGTACAGATTTTTTCTCGCATAGTAGTTACAATAGCAGAGACGCAAACGTGTAAATATCATACACAGATTGTTCTTTTTCTTCTCTCGCCATTAGTGGCACAAACCATTAAGAAATATCCTAGTTGTGTCTCAAAAACTCACCATCTTTCGCGACTAAAACCAGCACATCAAAGCTGAGCCTTCTCAGAGTGATTGAAACAAAACAGAGGATTACAGAGGAGCTAGTGGTTGAACAGAAAGATGAGAAAAAGGGATATAGATGGGTACAAGAGAGGCTTCGTTTCTTACATGAAATTACTTTTGTATCTATTTTTTCTATTCTTATACGTTCAAGTTTGCACATTATGTGACATTACTTATATAATAAATCAATAAAAATCAATTTGTCTCTaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.11547 translated coding region predicted by ESTScan from UniGene At.11547

MATTPVQPPVSNSPPVTSPPPPLNNATSPATPPPVTSPLPPSAPPPNRAPPPPPPVTTSPPPVANGAPPPPLPKPPESSSPPPQPVIPSPPPSTSPPPQPVIPSPPPSASPPPALVPPLPSSPPPPASVPPPRPSPSPPILVRSPPPSVRPIQSPPPPPSDRPTQSPPPPSPPSPPSERPTQSPPSPPSERPTQSPPPPSPPSPPSDRPSQSPPPPPEDTKPQPPRRSPNSPPPTFSSPPRSPPEILVPGSNNPSQNNPTLRPPLDAPNSTNNSGIGTGAVVGISVAVALVVFTLFGIFVWCLRKREKRLSAVSGGDVTPSPMSSTARSDSAFFRMQSSAPVGASKRSGSYQSQSGGLGNSKALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAEDLTNGMRLGESEVFNSAQQSAEIRLFRRMAFGSQNYSTDFFSHSSYNSRDANV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF644
185-708 PTHR24420:SF644

PSPPSERPTQSPPPPSPPSPPSDRPSQSPPPPPEDTKPQPPRRSPNSPPPTFSSPPRSPPEILVPGSNNPSQNNPTLRPPLDAPNSTNNSGIGTGAVVGISVAVALVVFTLFGIFVWCLRKREKRLSAVSGGDVTPSPMSSTARSDSAFFRMQSSAPVGASKRSGSYQSQSGGLGNSKALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAEDLTNGMRLGESEVFNSAQQSAEIRLFRRMAFGSQNYSTDFFSHSSYNSRDANV

HMMPanther: PTHR24420
185-708 PTHR24420,FAMILY NOT NAMED

PSPPSERPTQSPPPPSPPSPPSDRPSQSPPPPPEDTKPQPPRRSPNSPPPTFSSPPRSPPEILVPGSNNPSQNNPTLRPPLDAPNSTNNSGIGTGAVVGISVAVALVVFTLFGIFVWCLRKREKRLSAVSGGDVTPSPMSSTARSDSAFFRMQSSAPVGASKRSGSYQSQSGGLGNSKALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAEDLTNGMRLGESEVFNSAQQSAEIRLFRRMAFGSQNYSTDFFSHSSYNSRDANV

superfamily: SSF56112
IPR011009
349-672 Kinase_like
Protein kinase-like domain

GSYQSQSGGLGNSKALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESLAAEDLTNGMRLGESEVFNSA

Gene3D: G3DSA:3.30.200.20
363-438 G3DSA:3.30.200.20

ALFSYEELVKATNGFSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVG

ProfileScan: PS50011
IPR000719
377-652 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVEWARPLISHAIETEEFDSLADPKLGGNYVESEMFRMIEAAGACVRHLATKRPRMGQIVRAFESL

HMMPfam: PF00069
IPR017442
379-589 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

QENLLGEGGFGCVYKGILPDGRVVAVKQLKIGGGQGDREFKAEVETLSRIHHRHLVSIVGHCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQPLGDESLVE

PatternScan: PS00107
IPR017441
383-405 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVYKGILPDGRVVAVK

Gene3D: G3DSA:1.10.510.10
439-580 G3DSA:1.10.510.10

HCISGDRRLLIYDYVSNNDLYFHLHGEKSVLDWATRVKIAAGAARGLAYLHEDCHPRIIHRDIKSSNILLEDNFDARVSDFGLARLALDCNTHITTRVIGTFGYMAPEYASSGKLTEKSDVFSFGVVLLELITGRKPVDTSQ

PatternScan: PS00108
IPR008271
496-508 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox