PRGDB00065931 (At.11770)

From PRG Wiki
Jump to: navigation, search
At.11770
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145337828 (NM_106730)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CCR2 (CINNAMOYL COA REDUCTASE); cinnamoyl-CoA reductase (CCR2) mRNA, complete cds

DNA Sequence

TACTACTCTCTTAAGCCCTTTCATAACCTTGTAAACCATTAAGAGGCTTTGCTCAATTACAAGAAGAAGAAAAAATGCTTGTCGACGGGAAACTCGTCTGCGTCACCGGAGCCGGCGGCTACATTGCTTCTTGGATCGTTAAGTTACTCTTAGAGAGAGGCTACACCGTTAGAGGAACCGTAAGGAACCCAACTGATCCCAAGAACAACCATCTCAGAGAGCTTCAAGGAGCCAAGGAAAGACTCACTCTTCACAGTGCAGATCTTCTCGACTACGAAGCTCTCTGTGCCACAATCGACGGTTGCGATGGCGTTTTCCACACTGCCTCTCCGATGACCGACGATCCCGAGACAATGTTGGAGCCGGCGGTGAACGGAGCCAAGTTCGTGATTGACGCAGCGGCTAAAGCCAAGGTCAAGCGCGTGGTTTTCACGTCATCAATTGGTGCAGTTTACATGAACCCTAACCGTGACACTCAAGCCATTGTTGACGAAAACTGCTGGAGTGATCTTGATTTCTGCAAAAACACTAAGAATTGGTATTGCTACGGGAAGATGTTGGCGGAACAATCGGCATGGGAGACGGCCAAAGCAAAAGGTGTGGACTTAGTGGTGCTAAATCCGGTTTTGGTTCTCGGACCACCGCTCCAGTCAGCGATCAACGCTAGTCTAGTCCATATTCTCAAGTACCTCACCGGCTCAGCCAAGACCTACGCTAACTTGACTCAGGTCTACGTGGACGTCCGTGACGTGGCACTAGGCCATGTTCTGGTCTACGAAGCACCCTCCGCCTCAGGCCGTTACATCCTCGCCGAGACCGCACTTCACCGCGGAGAGGTTGTTGAGATTCTGGCCAAATTCTTCCCGGAGTATCCACTTCCCACCAAGTGTTCGGACGAGAAGAATCCGAGGGCTAAGCCATACAAGTTTACTACCCAAAAGATAAAAGACTTAGGCTTGGAATTTAAACCCATCAAGCAATCTCTTTACGAATCTGTCAAGAGCTTGCAAGAGAAAGGCCATCTTCCTCTACCTCAAGATTCGAACCAAAACGAAGTCATCATCGAATCTTAGGACACGATCCACGACCCTAGAATCTGATCATACCTACATGAAAAGCTTTATTCTTAAGTAATACATACGTTTTGATTTTGACTAAAGTATTGTTAAATCTTAAATCATTATATATAGCTGATTGTTCTTTCTTTCTTTGGTTGTAATTGAGAATATGTTACGCATATGTATTATACGATAATGGAAGCAATGGTTTTATTATCCGATGTT


Protein sequences

Name Description Sequence
At.11770 translated coding region predicted by ESTScan from UniGene At.11770

MLVDGKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVEILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPIKQSLYESVKSLQEKGHLPLPQDSNQNEVIIES

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-313 NAD(P)-bd

MLVDGKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVEILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPIKQSLYESVKSLQE

HMMPanther: PTHR10366
3-329 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

VDGKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVEILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPIKQSLYESVKSLQEKGHLPLPQDSNQNEVI

HMMPanther: PTHR10366:SF9
3-329 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

VDGKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVEILAKFFPEYPLPTKCSDEKNPRAKPYKFTTQKIKDLGLEFKPIKQSLYESVKSLQEKGHLPLPQDSNQNEVI

Gene3D: G3DSA:3.40.50.720
IPR016040
5-264 NAD(P)-bd
NAD(P)-binding domain

GKLVCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRYILAETALHRGEVVEILAKFFP

HMMPfam: PF01370
IPR001509
8-243 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGYIASWIVKLLLERGYTVRGTVRNPTDPKNNHLRELQGAKERLTLHSADLLDYEALCATIDGCDGVFHTASPMTDDPETMLEPAVNGAKFVIDAAAKAKVKRVVFTSSIGAVYMNPNRDTQAIVDENCWSDLDFCKNTKNWYCYGKMLAEQSAWETAKAKGVDLVVLNPVLVLGPPLQSAINASLVHILKYLTGSAKTYANLTQVYVDVRDVALGHVLVYEAPSASGRY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox