PRGDB00065933 (At.11883)

From PRG Wiki
Jump to: navigation, search
At.11883
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 13877528 (AF370465)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Unknown protein (T20M3.2) mRNA, complete cds

DNA Sequence

AAAAAGAGCTTTTGAGTTTTGGTCGTACaaaaaaaaaGAAAGGGAAAATGAAGATAGGACCTGTAGGGAAGCATGATGCTAGAAGCACTACAATTGTAAACTGGGGCGAAGGATCTCACGATGGCTTCATCTCTCAGATTTTTCTATCTCATGGCGTCGCTGGAATTATGTCTATCCAATTCCAGTTCGTGATGGACGGAAAACTCGTTTTATCCGATCGTCACGGTCCATTTTCCGGCAACATGTTTGACGTTATAGAGCTCAACTATCCGCATGAGTACATAACTGGAATCAGTGGAGAGTATTACAAGTATGAAGCCAACAATCCTCACATGAGGTCTCTCAAATTCAATACCAACACTAGCGAGTACGGTCCTTTTGGCACCTCCGGTTCGAGCAACGACAAATTTGCTTTTAAACTCGGGAAATCTCCTCAGTTCGGCGGTTTCCATGGGACTTATGATGCCTCGGGACTACAGTACATTGGTGTTTATCTCCGCCCAAAAACAGTTCTACCCAAAATAGATACGGGCAATGCAGAGGAAACAGAGTCAAAAATTGTACTGGGCTGAAAGTGTTTGTATACGACTCTATTCTGCTGATTGTACATTCTTAATTATGAAAATTCTTCTATGAATaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
At.11883 translated coding region predicted by ESTScan from UniGene At.11883

MKIGPVGKHDARSTTIVNWGEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRPKTVLPKIDTGNAEETESKIVLG

Domains

Domain Start-End Description Sequence

superfamily: SSF51101
IPR001229
1-152 Mannose-bd_lectin
Mannose-binding lectin

MKIGPVGKHDARSTTIVNWGEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

Gene3D: G3DSA:2.100.10.30
IPR001229
2-152 Mannose-bd_lectin
Mannose-binding lectin

KIGPVGKHDARSTTIVNWGEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

HMMSmart: SM00915
IPR001229
16-152 Jacalin
Mannose-binding lectin

IVNWGEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP

HMMPfam: PF01419
IPR001229
19-152 Jacalin
Mannose-binding lectin

WGEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox