PRGDB00065936 (At.12093)

From PRG Wiki
Jump to: navigation, search
At.12093
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79317069 (NM_001035904)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana serine

DNA Sequence

CGAGAAGATTTTTTCGTAATTCGTTGTTAATTTCTCTCGTTGGTCAGATATATTTCGATATCTATTATTATTATTTGGTGATTTTTTCATATCTGGAAATTGAGTAAGTAACGAtttttttttttaaaaaaaaaaaagagagagagagagattaggaaacaagaaagcagaaagagaggagtgattagagagagagagagaTCAATAACCAAAGAAGAAGGAAGGGAAGGGGATTAGATTACAAAAACGCCAAAGCTGTTAACTTTTTCTTTTTGGCCATTTCCTATTTCTCCCTTCGTCTCCATCAAGCAACCctctctctctctctctctctATCATCATCATCGCAGAGGAGACGATCTTACGCGACGAATCCTTGAGAGATTGAGAGGGACAAGCGAGTTTTGTAGGTGTCTCAGACCGGACCCAAGGATTGTTGACGGTCTATATTGAACAAGTAAACAAGGATGCGTAAGTGGATCTGTTGTACATGTCAAATAGAAGACTCAAATGAAGAGCAACAACTGAAAAGTTCACAGCAGCAATCTGATGCAAATCATAAGAATTCAAAACCAGCACCTGTTGCAAAACATGAGGTTAAGAAGGAAGCTCTTCCCATCGAGGTCCCTCCCTTGTCTTTGGATGAGGTCAAGGAAAAGACTGAAAATTTTGGATCCAAGGCACTGATTGGTGAAGGGTCTTATGGGAGAGTATATTATGCGACACTAAATGATGGTGTGGCGGTTGCTCTGAAGAAACTTGATGTCGCACCTGAAGCTGAAACAGATACCGAATTCTTGAGTCAGGTTTCCATGGTCTCTAGGCTGAAGCATGAAAATCTCATTCAATTGCTTGGTTTTTGTGTTGATGGAAACCTCCGCGTCCTTGCATATGAGTTTGCAACAATGGGATCGTTGCATGACATCTTGCATGGTAGGAAGGGAGTTCAAGGAGCACAACCAGGTCCAACACTTGACTGGATAACGAGGGTGAAGATAGCGGTTGAGGCAGCTAGGGGTTTGGAATACCTCCATGAGAAGTCTCAGCCTCCTGTAATCCATAGGGACATAAGATCTAGCAATGTCCTTCTTTTTGAAGACTACAAAGCAAAGATTGCTGATTTCAATCTCTCGAATCAAGCACCTGATAATGCTGCCCGTCTTCACTCAACAAGAGTCTTGGGGACTTTTGGTTATCATGCTCCAGAATATGCAATGACTGGACAGTTAACTCAGAAGAGTGATGTGTACAGCTTTGGTGTTGTACTTCTAGAACTTCTTACAGGGAGGAAACCGGTGGATCATACCATGCCTAGAGGTCAACAGAGTCTTGTAACCTGGGCGACACCAAGACTCAGTGAAGATAAAGTGAAACAGTGCATTGATCCAAAGCTAAAAGCCGATTACCCTCCAAAAGCAGTTGCTAAGCTAGCAGCGGTGGCAGCATTGTGTGTGCAATACGAAGCTGAGTTTAGACCAAATATGAGCATAGTTGTGAAGGCGCTACAGCCTCTCCTGAAACCTCCAGCAGCAGCTCCAGCACCAGAATCTTGAAACTTTTAAATCttttttttCGCTGCAACTATCAGAAAGAATCTACATAGTACCATTTGCCATAAATGATAATGAGGTTGGTTTTGAGAGTGATAACTACTATTATTAAAAGATGATATTATGTTTCATTTGATGATTTGATTTTGCACACAAATTTTGTTGTGCTAGAAAGAGAGAGAGATAATTGATGGCAAAGTTTATTGTTGCCGTTTGCTGAGTGGGAGAGAAAGGAACTCTGATTTTATTTATATGATCCCTCTTATTCCTAT


Protein sequences

Name Description Sequence
At.12093 translated coding region predicted by ESTScan from UniGene At.12093

MRKWICCTCQIEDSNEEQQLKSSQQQSDANHKNSKPAPVAKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPES

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
38-346 Kinase_like
Protein kinase-like domain

PVAKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL

HMMPanther: PTHR24420:SF416
40-361 PTHR24420:SF416,SUBFAMILY NOT NAMED

AKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPES

HMMPanther: PTHR24420
40-361 PTHR24420,FAMILY NOT NAMED

AKHEVKKEALPIEVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLLKPPAAAPAPES

Gene3D: G3DSA:3.30.200.20
52-144 G3DSA:3.30.200.20

EVPPLSLDEVKEKTENFGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEF

ProfileScan: PS50011
IPR000719
68-350 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
72-346 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ALIGEGSYGRVYYATLNDGVAVALKKLDVAPEAETDTEFLSQVSMVSRLKHENLIQLLGFCVDGNLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
74-96 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYATLNDGVAVALK

Gene3D: G3DSA:1.10.510.10
148-345 G3DSA:1.10.510.10

GSLHDILHGRKGVQGAQPGPTLDWITRVKIAVEAARGLEYLHEKSQPPVIHRDIRSSNVLLFEDYKAKIADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCIDPKLKADYPPKAVAKLAAVAALCVQYEAEFRPNMSIVVKA

PatternScan: PS00109
IPR008266
196-208 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

VIHRDIRSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox