PRGDB00065944 (At.13683)

From PRG Wiki
Jump to: navigation, search
At.13683
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79324529 (NM_001036421)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana kinase (AT2G37050) mRNA, complete cds

DNA Sequence

CTCTCTCACATAAAAAAAGCAAACACTTAACGAGGAAGAAACACACTCATATCTCCTCACGTTCCCCaattttttgatttttattatctttttgggtttttgggtttGGTTAAACCATTTATGGGTCTTTAGATCTCTCTTGATAGTAAAGATAAGTAATTTTAGGGTCTGTTTGGTTCTGTTTCTGGAAAtttcacttttttcacttttttgggatcacatttagctttttttggttcctttattttGTAACGCCATTTATGCGTTAAACTTGTGTGAAGTGTTTGTTTGGTCTGAGCTGGAGATGGTGAGAATCTCACTGCTTTTGTTGTGTTTACTGGTTTCAACTTGTCTCTTCACTTCTTCATCAGCACAAGCTCCAGGTTTTGTGAGCTTGGATTGTGGAGGTGCAGAGCCATTCACTGATGAACTTGGACTCAAATGGTCACCTGATAATCATCTCATTTATGGAGAAACCGCTAATATATCGTCCGTTAACGAAACAAGAACTCAGTACACGACTTTAAGGCATTTCCCTGCTGATTCAAGAAAGTATTGCTACACTCTCAATGTCACGAGTAGGAATAGATATCTCATTAGAGCTACTTTCTTGTATGGTAATTTCGACAACAGCAACAATGTGTATCCCAAATTCGATATCTCCCTCGGGGCGACTCATTGGGCGACCATTGTTATCTCTGAAACCTATATAATCGAAACTGCAGAACTGGTGTTTCTGGCTTCTTCTCCTACTGTTAGTGTTTGTTTGTCAAATGCCACAACTGGACAGCCGTTTATATCTACTCTTGAGCTTAGGCAGTTGAGTGGTTCGATGTATGGTTCGATGCTATCTGAAGACCGGTTTTACCTGAGTGTTGCAGCACGGATAAATTTCGGGGCTGAAAGTGAAGCTTCTGTGAGGTACCCGGATGATCCGTATGATAGAATATGGGAATCTGATTTGCAAAAGAAGCCTAATTATCTTGTGGATGTTGCTGCTGGGACTGTGCGAGTGTCGACTACATTGCCAATCGAAAGCAGGGTCGATGACAGACCGCCTCAGAAGGTTATGCAGACGGCTGTGGTTGGAACAAACGGGTCCTTAACTTACAGAATGAACCTAGATGGCTTCCCTGGTTTTGGTTGGGCATTCACATACTTTGCTGAAATCGAGGATTTGGCTGAGGATGAGTCAAGGAAGTTTAGATTAGTTCTACCTGAGCAGCCTGAGTATAGCAAATCGGTTGTTAACATCAAGGAAAATACACAGAGACCGTATCGCGTTTATGCACCTGGCTATCCTAACATAACACTTCCATTTGTGCTAAACTTTCGATTTGCCAAAACGGCTGATTCTTCTAGGGGACCTATTCTGAATGCCATGGAGATCAGCAAATATTTGCGGAAAAGCGATGGTTCAGTAGATGCAACTGTTATGGCTAATGTGGCATCGCTATATTCTTCCACTGAATGGGCTCAAGAAGGCGGTGACCCTTGTTCACCCTCACCGTGGTCATGGGTGCAATGCAATTCGGATCCACAACCAAGGGTTGTTGCTATCAAGCTGTCGAGTATGAACTTGACGGGAAATATACCTTCTGACCTGGTGAAATTGACTGGTTTGGTTGAGTTATGGCTTGATGGGAATTCTTTTACGGGTCCAATACCGGATTTCTCTCGGTGTCCAAACCTGGAGATAATACACCTCGAGAACAACCGACTAACCGGAAAGATCCCTTCCTCGTTGACGAAACTCCCAAACCTGAAAGAACTGTACCTGCAGAACAATGTGTTAACAGGAACAATACCATCAGACCTGGCCAAAGATGTGATCTCAAACTTCTCTGGGAACCTTAACCTTGAAAAAAGTGGAGATAAAGGCAAGAAGCTCGGTGTCATCATCGGTGCATCAGTTGGTGCTTTTGTTCTGCTAATTGCAACCATCATTTCTTGCATCGTCATGTGCAAAAGCAAGAAGAATAACAAGTTGGGAAAAACTTCGGAGTTAACGAATCGTCCCTTACCGATTCAGAGAGTTTCGTCTACCTTGAGTGAAGCTCATGGAGACGCTGCACATTGCTTCACACTTTATGAGATCGAGGAAGCCACAAAAAAATTCGAAAAGAGAATTGGGTCGGGAGGTTTTGGAATCGTATACTATGGTAAAACAAGGGAGGGGAAAGAGATTGCTGTAAAGGTTCTTGCAAATAATTCATATCAGGGAAAGAGAGAGTTTGCAAACGAGGTTACATTACTCTCAAGGATACATCATCGGAACCTTGTGCAGTTTCTTGGTTATTGCCAAGAAGAGGGAAAAAACATGCTTGTGTATGAGTTCATGCACAATGGGACTTTGAAGGAGCATCTTTATGGCGTGGTACCACGTGACCGGAGAATCAGTTGGATTAAAAGGCTTGAGATAGCTGAAGATGCAGCCCGAGGTCCGTGAATTGTACAACAAAACAGAAAGCcattttttcgatatttgattttgttggttttgattgtttCTGTAGGGATCGAGTATCTTCACACAGGGTGTGTTCCAGCAATCATACATAGAGATCTCAAGACTAGTAACATCCTACTTGACAAACACATGAGGGCAAAGGTTTCAGATTTCGGTTTGTCGAAATTCGCAGTTGACGGGACCTCACATGTCTCCAGCATTGTCCGTGGCACAGTTGGATATCTTGACCCCGAGTACTATATATCGCAGCAGTTAACAGAGAAGAGTGATGTATATAGCTTCGGAGTCATTCTTCTTGAGCTAATGTCTGGCCAAGAAGCCATATCGAATGAAAGCTTTGGTGTCAACTGCCGGAACATAGTCCAATGGGCTAAGATGCATATAGACAACGGGGACATCCGAGGGATCATCGATCCAGCGCTAGCGGAAGATGATTACAGTCTCCAATCAATGTGGAAGATTGCGGAGAAAGCGTTGCTGTGTGTGAAACCGCACGGGAACATGAGACCTTCGATGTCCGAGGTGCAAAAAGATATCCAAGACGCGATTAGGATCGAGAAGGAAGCGTTGGCTGCAAGAGGCGGTATATCAGACGAGTTTTCCAGGAGCTCGGCTCATTCGTCTTCGCTCAACATGGGAATGCTTGACCTGGCTGGATCACAGAGTTATGTATCCATTGATGAATCAGTATTGCAGCCAACAGCTCGGTAGTAGATTCGGCTTTGTTTGTACAGATGCATTACTTGCTTGTGTTTTTGACCTTTCACATTGTCTCTGGTCTTTAGTTATTAGTTTTGAGCTTAACACTACttttttttctttcttttggactcgaggttacaagaagtgcttcgagtttgtttgtttttcttttattgttttCAGACTAACTCGGTGATTTATGTGGGATTGTGATATATTATGTTTTCTTTTAACTGATTTTCACATTTTCAACTGATT


Protein sequences

Name Description Sequence
At.13683 translated coding region predicted by ESTScan from UniGene At.13683

MVRISLLLLCLLVSTCLFTSSSAQAPGFVSLDCGGAEPFTDELGLKWSPDNHLIYGETANISSVNETRTQYTTLRHFPADSRKYCYTLNVTSRNRYLIRATFLYGNFDNSNNVYPKFDISLGATHWATIVISETYIIETAELVFLASSPTVSVCLSNATTGQPFISTLELRQLSGSMYGSMLSEDRFYLSVAARINFGAESEASVRYPDDPYDRIWESDLQKKPNYLVDVAAGTVRVSTTLPIESRVDDRPPQKVMQTAVVGTNGSLTYRMNLDGFPGFGWAFTYFAEIEDLAEDESRKFRLVLPEQPEYSKSVVNIKENTQRPYRVYAPGYPNITLPFVLNFRFAKTADSSRGPILNAMEISKYLRKSDGSVDATVMANVASLYSSTEWAQEGGDPCSPSPWSWVQCNSDPQPRVVAIKLSSMNLTGNIPSDLVKLTGLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNVLTGTIPSDLAKDVISNFSGNLNLEKSGDKGKKLGVIIGASVGAFVLLIATIISCIVMCKSKKNNKLGKTSELTNRPLPIQRVSSTLSEAHGDAAHCFTLYEIEEATKKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDIQDAIRIEKEALAARGGISDEFSRSSAHSSSLNMGMLDLAGSQSYVSIDESVLQPTAR

Domains

Domain Start-End Description Sequence

Seg: seg
5-22 seg

SLLLLCLLVSTCLFTSSS

HMMPfam: PF12819
IPR024788
31-364 Malectin_like,Carbohydrate-binding protein of the ER
Malectin-like carbohydrate-binding domain

LDCGGAEPFTDELGLKWSPDNHLIYGETANISSVNETRTQYTTLRHFPADSRKYCYTLNVTSRNRYLIRATFLYGNFDNSNNVYPKFDISLGATHWATIVISETYIIETAELVFLASSPTVSVCLSNATTGQPFISTLELRQLSGSMYGSMLSEDRFYLSVAARINFGAESEASVRYPDDPYDRIWESDLQKKPNYLVDVAAGTVRVSTTLPIESRVDDRPPQKVMQTAVVGTNGSLTYRMNLDGFPGFGWAFTYFAEIEDLAEDESRKFRLVLPEQPEYSKSVVNIKENTQRPYRVYAPGYPNITLPFVLNFRFAKTADSSRGPILNAMEISK

HMMPanther: PTHR24420:SF549
330-958 SUBFAMILY NOT NAMED

PGYPNITLPFVLNFRFAKTADSSRGPILNAMEISKYLRKSDGSVDATVMANVASLYSSTEWAQEGGDPCSPSPWSWVQCNSDPQPRVVAIKLSSMNLTGNIPSDLVKLTGLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNVLTGTIPSDLAKDVISNFSGNLNLEKSGDKGKKLGVIIGASVGAFVLLIATIISCIVMCKSKKNNKLGKTSELTNRPLPIQRVSSTLSEAHGDAAHCFTLYEIEEATKKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDIQDAIRIEKEALAARGGISDEFSRSSAHSSSLNMGMLDLAGSQSYVSIDESVLQPTAR

HMMPanther: PTHR24420
330-958 FAMILY NOT NAMED,FAMILY NOT NAMED

PGYPNITLPFVLNFRFAKTADSSRGPILNAMEISKYLRKSDGSVDATVMANVASLYSSTEWAQEGGDPCSPSPWSWVQCNSDPQPRVVAIKLSSMNLTGNIPSDLVKLTGLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNVLTGTIPSDLAKDVISNFSGNLNLEKSGDKGKKLGVIIGASVGAFVLLIATIISCIVMCKSKKNNKLGKTSELTNRPLPIQRVSSTLSEAHGDAAHCFTLYEIEEATKKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDIQDAIRIEKEALAARGGISDEFSRSSAHSSSLNMGMLDLAGSQSYVSIDESVLQPTAR

Gene3D: G3DSA:3.80.10.10
396-507 no description

DPCSPSPWSWVQCNSDPQPRVVAIKLSSMNLTGNIPSDLVKLTGLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNVLTGTIPSDLAK

superfamily: SSF52058
396-507 L domain-like,LRR

DPCSPSPWSWVQCNSDPQPRVVAIKLSSMNLTGNIPSDLVKLTGLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNVLTGTIPSDLAK

HMMPfam: PF13855
439-496 LRR_8,Leucine rich repeat

GLVELWLDGNSFTGPIPDFSRCPNLEIIHLENNRLTGKIPSSLTKLPNLKELYLQNNV

superfamily: SSF56112
IPR011009
575-901 Protein kinase-like (PK-like)
Protein kinase-like domain

IQRVSSTLSEAHGDAAHCFTLYEIEEATKKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDI

Gene3D: G3DSA:3.30.200.20
588-664 no description

DAAHCFTLYEIEEATKKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLG

ProfileScan: PS50011
IPR000719
603-882 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALL

HMMSmart: SM00220
IPR002290
603-905 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

KKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDIQDAI

HMMSmart: SM00219
IPR020635
603-901 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KKFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEVQKDI

HMMPfam: PF07714
IPR001245
604-829 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

KFEKRIGSGGFGIVYYGKTREGKEIAVKVLANNSYQGKREFANEVTLLSRIHHRNLVQFLGYCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEA

PatternScan: PS00107
IPR017441
609-631 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGGFGIVYYGKTREGKEIAVK

Gene3D: G3DSA:1.10.510.10
665-897 no description

YCQEEGKNMLVYEFMHNGTLKEHLYGVVPRDRRISWIKRLEIAEDAARGPXIVQQNRKPFFRYLILLVLIVSVGIEYLHTGCVPAIIHRDLKTSNILLDKHMRAKVSDFGLSKFAVDGTSHVSSIVRGTVGYLDPEYYISQQLTEKSDVYSFGVILLELMSGQEAISNESFGVNCRNIVQWAKMHIDNGDIRGIIDPALAEDDYSLQSMWKIAEKALLCVKPHGNMRPSMSEV

Seg: seg
728-735 seg

LILLVLIV

PatternScan: PS00108
IPR008271
750-762 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox