PRGDB00066003 (At.20009)

From PRG Wiki
Jump to: navigation, search
At.20009
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357722 (NM_120770)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana PGIP2 (POLYGALACTURONASE INHIBITING PROTEIN 2); protein binding (PGIP2) mRNA, complete cds

DNA Sequence

AAAACACAAACACCAAAAACACTATGGATAAGACAATGACACTGTTCTTGCTCTTGTCCACTCTCCTCCTCACGACTTCTTTAGCTAAAGATCTCTGTCATAAAGATGACAAAACTACCCTCCTCAAGATCAAGAAATCCCTAAACAACCCTTACCACCTCGCCTCATGGGATCCCAAAACCGACTGTTGCTCTTGGTACTGCCTCGAGTGCGGCGACGCTACTGTCAACCACCGTGTCACTTCCCTAATCATACAAGACGGCGAGATCTCCGGTCAGATCCCCCCTGAAGTCGGTGACTTACCGTATCTTACATCCCTTATCTTCCGCAAACTCACTAACCTCACTGGTCACATCCAACCCACTATCGCCAAGCTCAAGAACCTCACTTTTCTCAGACTAAGCTGGACCAATCTCACCGGTCCGGTTCCTGAGTTTCTGAGTCAGCTCAAGAATCTTGAGTACATTGACCTTTCCTTCAATGACCTCTCTGGTTCCATACCTAGTTCCCTCTCTTCATTACGTAAACTCGAGTATCTTGAACTTAGTAGGAACAAGCTTACAGGTCCGATACCAGAGTCATTTGGGACGTTTTCAGGAAAGGTCCCTAGTCTTTTCCTATCACACAACCAGCTCTCTGGTACTATACCAAAGTCACTAGGCAATCCCGACTTTTACCGCATCGATTTATCTCGGAACAAGCTTCAAGGCGATGCTTCAATCTTGTTTGGAGCTAAAAAAACAACATGGATCGTTGATATATCAAGAAACATGTTCCAGTTCGATCTCTCCAAGGTTAAGCTCGCTAAGACACTTAATAACTTGGACATGAATCACAATGGCATCACAGGGAGTATTCCGGCTGAGTGGAGCAAAGCTTATTTTCAGTTACTGAATGTTAGCTATAACAGACTGTGTGGACGCATCCCCAAAGGAGAGTATATTCAAAGATTTGATTCTTATTCCTTTTTCCACAACAAGTGTTTATGTGGTGCACCTCTTCCTAGTTGCAAGTGAAGATTCCAGCAAAACCAAGCATTATCTCTGATATACCAAATAATTAATCAAGTCTAGTGACAATTGTGTTTTTATTTTGAATGATTAATAAAAGCATGAACCAATGTTTTAGCTTGATTTCATTGATTAACGGAAAAAGTTGAACAAAAA


Protein sequences

Name Description Sequence
At.20009 translated coding region predicted by ESTScan from UniGene At.20009

XNTNTKNTMDKTMTLFLLLSTLLLTTSLAKDLCHKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK


Domains

Domain Start-End Description Sequence

Seg: seg
1-28 seg

XNTNTKNTMDKTMTLFLLLSTLLLTTSL

HMMPanther: PTHR24420:SF915
1-338 PGIP2 (POLYGALACTURONASE INHIBITING PROTEIN 2); PROTEIN BINDING

XNTNTKNTMDKTMTLFLLLSTLLLTTSLAKDLCHKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK

HMMPanther: PTHR24420
1-338 FAMILY NOT NAMED,FAMILY NOT NAMED

XNTNTKNTMDKTMTLFLLLSTLLLTTSLAKDLCHKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK

superfamily: SSF52058
31-338 L domain-like,LRR

DLCHKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPLPSCK

Gene3D: G3DSA:3.80.10.10
33-334 no description

CHKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLECGDATVNHRVTSLIIQDGEISGQIPPEVGDLPYLTSLIFRKLTNLTGHIQPTIAKLKNLTFLRLSWTNLTGPVPEFLSQLKNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLTGPIPESFGTFSGKVPSLFLSHNQLSGTIPKSLGNPDFYRIDLSRNKLQGDASILFGAKKTTWIVDISRNMFQFDLSKVKLAKTLNNLDMNHNGITGSIPAEWSKAYFQLLNVSYNRLCGRIPKGEYIQRFDSYSFFHNKCLCGAPL

HMMPfam: PF08263
IPR013210
34-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HKDDKTTLLKIKKSLNNPYHLASWDPKTDCCSWYCLEC

Seg: seg
35-46 seg

KDDKTTLLKIKK

HMMPfam: PF13516
126-148 LRR_6,Leucine Rich repeat

LKNLTFLRLSWTNLTGPVPEFLS

HMMPfam: PF12799
151-188 LRR_4,Leucine Rich repeats (2 copies)

KNLEYIDLSFNDLSGSIPSSLSSLRKLEYLELSRNKLT

FPrintScan: PR00019
153-166 LEURICHRPT,Leucine-rich repeat signature

LEYIDLSFNDLSGS

Seg: seg
163-177 seg

LSGSIPSSLSSLRKL

FPrintScan: PR00019
174-187 LEURICHRPT,Leucine-rich repeat signature

LRKLEYLELSRNKL

HMMPfam: PF00560
IPR001611
205-222 LRR_1
Leucine-rich repeat

LFLSHNQLSGTIPKSLGN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox