PRGDB00066006 (At.20284)

From PRG Wiki
Jump to: navigation, search
At.20284
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79326679 (NM_001036743)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CIPK15 (CBL-INTERACTING PROTEIN KINASE 15); kinase

DNA Sequence

ATGAGAAGTGATAACTTATTTTAAGGGCTAAGAACAACAACAAAGTTGATTATTAGAAGAAAGAAATAATTAAAAAGCAAATTGCAAACAGCGAAAAGAGAGATGATGACAAAAAATGGTTAGTAACGGCCAAAAGCTGAAGCTATTTGGCATATACTTGTCTTCGCTTTTCGTAGCTCTTTCGCGCATAATAATAACTGAGGTTGTTGTTTAATCAAGAAGAGTGTGCAAAAATTGGAAGGCCAGGGAATGCAGAAACATGTATTTGAAAGCTGAACTCAATTGCTCTACACCACCCTCTCAGATCCTTTGTCCCTTTGGGCCCTTGTTCTCCCTCATCCCTTATGTGGACACCCATTTTCTAAACCCCTGCTTCCACACCTTCCAGCCTTCCTCTCACAATGCTAGAAAAAACGCCACTTGGAAGCATGATCTTTGCGAAGACGGTTGATCCGACACTAACAGCCTCCTCCTGAGTTCCTCCTCTACCCTTTATGTTGTCTGCGTTTTAGTATATTCTAGGGTGGTCTTTTTATTTAGTGGTATTAGTAGTGCTCTAAGCTAACCAGTTAGTCAATGGAGAAGAAAGGATCTGTGTTGATGCTCCGTTATGAGGTTGGGAAGTTTCTCGGTCAAGGTACCTTTGCTAAGGTATACCATGCTAGGCATTTGAAAACTGGTGATAGTGTAGCGATTAAGGTCATCGACAAAGAAAGAATCCTCAAAGTTGGCATGACCGAGCAGATTAAGCGAGAGATCTCTGCCATGAGACTCTTGAGGCATCCCAACATCGTTGAGCTCCATGAAGTCATGGCCACCAAATCTAAAATCTACTTCGTCATGGAACATGTTAAGGGTGGTGAGCTCTTCAACAAAGTGTCAACTGGGAAGCTGAGAGAAGACGTTGCGAGAAAGTACTTTCAGCAGCTTGTACGCGCTGTTGACTTCTGTCACAGCCGTGGAGTATGCCACAGGGACCTGAAGCCGGAGAATCTCTTGTTGGATGAGCATGGGAATCTTAAGATCTCTGATTTTGGTCTCAGCGCTCTTTCTGACTCTAGAAGGCAAGACGGGTTGCTGCATACTACATGCGGGACCCCTGCATATGTTGCACCGGAGGTGATAAGCAGGAACGGGTATGATGGGTTTAAAGCGGATGTGTGGTCCTGTGGAGTGATATTGTTCGTCTTGCTCGCTGGATATCTTCCTTTCCGTGATTCCAATCTGATGGAGCTGTATAAGAAGATAGGCAAAGCTGAAGTCAAGTTCCCCAACTGGCTTGCTCCGGGGGCAAAGAGATTGCTCAAGAGGATCTTGGATCCTAACCCCAACACAAGGGTATCAACTGAGAAAATAATGAAGAGCTCTTGGTTCCGTAAAGGCCTACAAGAGGAGGTGAAAGAATCAGTTGAGGAAGAGACAGAAGTGGACGCAGAGGCAGAGGGAAACGCAAGTGCAGAGAAGGAAAAGAAGCGGTGTATCAACCTGAACGCGTTTGAGATCATATCTCTGTCCACGGGGTTTGATCTCTCGGGACTGTTCGAGAAGGGAGAGGAGAAGGAGGAGATGAGGTTTACATCAAACAGAGAGGCATCTGAGATAACAGAGAAGCTGGTGGAGATTGGGAAGGACCTTAAGATGAAAGTGAGGAAGAAGGAACACGAATGGAGGGTGAAAATGTCGGCTGAGGCTACAGTGGTGGAAGCGGAAGTGTTTGAGATTGCGCCGAGCTATCACATGGTGGTGCTAAAGAAGAGCGGTGGAGATACTGCTGAGTATAAGAGAGTCATGAAGGAGAGTATAAGACCGGCTTTGATCGACTTTGTATTAGCTTGGCACTGAAACATATTCTATCCtttttatgtgtcttcttcttttagaatgtttttcttgttttgttttgccaatgtgtttagtttATGTATTTTCTCTTGAGTCTCATCTTAAGACGTGTTTCGTATTTTTCTAGGTGTCAGTGTAACAATAATAATATGTGAGGACCAATTATATAGTTTGAGACAAAATAAGTAGATTTCTTTATCAGATAAAATAAAATAAATTGAGCCTTAATGAAATAAGCCAATAGACCGACAACGGTTTTAGGAAGCATTATACTACTATTTTGTAGTTATTTCGTATTATTGTAGTCTTTTGGATGATCTTTTTGTGTATTAACAAAGTCAAAACAAATTTATAATTTAACTTACGTTACAG


Protein sequences

Name Description Sequence
At.20284 translated coding region predicted by ESTScan from UniGene At.20284

MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREASEITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAPSYHMVVLKKSGGDTAEYKRVMKESIRPALIDFVLAWH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343
1-344 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREASEITE

HMMPanther: PTHR24343:SF45
1-344 SUBFAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE PTK1

MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREASEITE

Gene3D: G3DSA:3.30.200.20
9-108 no description

MLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLRE

superfamily: SSF56112
IPR011009
11-297 Protein kinase-like (PK-like)
Protein kinase-like domain

RYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNASAEKE

HMMPfam: PF00069
IPR017442
12-266 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWF

ProfileScan: PS50011
IPR000719
12-266 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWF

HMMSmart: SM00220
IPR002290
12-266 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWF

HMMSmart: SM00219
IPR020635
12-266 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTGKLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWF

PatternScan: PS00107
IPR017441
18-50 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVYHARHLKTGDSVAIKVIDKERILK

Gene3D: G3DSA:1.10.510.10
109-293 no description

DVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRRQDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYKKIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEETEVDAEAEGNAS

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VCHRDLKPENLLL

Seg: seg
272-289 seg

EEVKESVEEETEVDAEAE

ProfileScan: PS50816
IPR018451
299-323 NAF
NAF/FISL domain

KRCINLNAFEIISLSTGFDLSGLFE

HMMPfam: PF03822
IPR004041
303-359 NAF
NAF domain

NLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREASEITEKLVEIGKDLKMKVRK

Seg: seg
370-379 seg

AEATVVEAEV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox