PRGDB00066014 (At.20728)

From PRG Wiki
Jump to: navigation, search
At.20728
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145360490 (NM_128627)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana serine

DNA Sequence

AGTTTCTGGTTTTGACTTTACTTTGAAGCttttttttttCAGTACTAAGAAGCTGTGGAGGATCTATATTTGAAAGAAGAGAACAAGGATGCGTAGGTGGATCTGTTGTGGGGATAAAAAAGGAGATTCAGATTTATCAAATGAAGAGGTGCATTTGAAAAGTCCATGGCAAAATTCTGAGGCAAATCAAAAGAATCAAAAACCACAAGCTGTTGTAAAGCCTGAGGCGCAGAAAGAAGCTCTTCCCATCGAAGTTCCTCCCTTGTCTGTGGATGAGGTTAAAGAAAAGACTGACAATTTTGGATCTAAGTCTCTGATTGGTGAGGGTTCTTATGGAAGGGTATATTATGCAACTCTAAATGATGGGAAAGCAGTTGCTTTGAAGAAACTCGATGTTGCACCTGAAGCTGAAACAAACACCGAGTTCCTGAATCAGGTTTCCATGGTTTCAAGACTAAAACATGAGAATCTCATTCAACTGGTTGGTTATTGTGTTGATGAAAACCTCCGTGTTCTTGCTTATGAGTTTGCAACAATGGGATCACTGCACGACATTCTACATGGTAGGAAGGGAGTTCAAGGAGCACAGCCAGGTCCAACACTTGACTGGTTAACGAGGGTGAAGATAGCTGTTGAGGCAGCTAGGGGTTTAGAATACCTTCATGAGAAGGTTCAGCCTCCTGTAATACATAGAGACATAAGATCTAGCAATGTTCTCCTTTTTGAAGACTATCAAGCAAAAGTTGCAGATTTTAATCTCTCAAATCAAGCTCCTGATAATGCTGCTCGTCTTCACTCTACGAGAGTTTTAGGCACCTTTGGCTATCACGCTCCAGAATATGCTATGACAGGACAGTTAACGCAGAAGAGTGACGTGTATAGCTTTGGGGTTGTTCTTCTAGAGCTTTTGACAGGAAGGAAACCTGTAGATCATACAATGCCACGCGGCCAACAGAGTCTTGTAACTTGGGCTACACCGAGACTCAGTGAAGATAAAGTGAAGCAATGTGTTGATCCAAAGTTAAAAGGAGAATATCCTCCTAAATCAGTAGCCAAGCTAGCAGCGGTGGCAGCATTATGTGTGCAATACGAATCTGAGTTTAGACCAAATATGAGTATAGTTGTAAAAGCTTTGCAGCCACTTCTCAAACCACCAGCACCAGCCCCAGCCCCAGTACCGGAATCCTGAGTTTGTGCACCTTTTAAATACCAGCCATCTTCTTCGTGCAATAGAGTTGGGTTCTTTGTTCATACAAAGTGAGAATTATACTCTGATTTGGGAAAAACATAGACATGATCTTACTATTAGTTTTCATTTTGGTGTTAAAGAAGAGTGCTTAATATTTCTCATTTGTTATGTGAGGTATTGGAAACAGGCTTTTTTTACTTGATTGGCGTGGAGAACAAACATGTTTTGCATTTGGTGTCttttttttttGTTCTCCTTTTCTGAATATATTGACAAGCTCTGTTTAAGGGTTTCTGAATCCACCATTTG


Protein sequences

Name Description Sequence
At.20728 translated coding region predicted by ESTScan from UniGene At.20728

MRRWICCGDKKGDSDLSNEEVHLKSPWQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAPAPVPES

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF416
27-366 PTHR24420:SF416,SUBFAMILY NOT NAMED

WQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAPAPVPES

HMMPanther: PTHR24420
27-366 PTHR24420,FAMILY NOT NAMED

WQNSEANQKNQKPQAVVKPEAQKEALPIEVPPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAPAPVPES

Gene3D: G3DSA:3.30.200.20
55-147 G3DSA:3.30.200.20

EVPPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEF

superfamily: SSF56112
IPR011009
57-364 Kinase_like
Protein kinase-like domain

PPLSVDEVKEKTDNFGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLLKPPAPAPAPVP

ProfileScan: PS50011
IPR000719
71-353 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FGSKSLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
75-349 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLIGEGSYGRVYYATLNDGKAVALKKLDVAPEAETNTEFLNQVSMVSRLKHENLIQLVGYCVDENLRVLAYEFATMGSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
77-99 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYYATLNDGKAVALK

Gene3D: G3DSA:1.10.510.10
151-348 G3DSA:1.10.510.10

GSLHDILHGRKGVQGAQPGPTLDWLTRVKIAVEAARGLEYLHEKVQPPVIHRDIRSSNVLLFEDYQAKVADFNLSNQAPDNAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRLSEDKVKQCVDPKLKGEYPPKSVAKLAAVAALCVQYESEFRPNMSIVVKA

PatternScan: PS00109
IPR008266
199-211 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

VIHRDIRSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox