PRGDB00066015 (At.20733)

From PRG Wiki
Jump to: navigation, search
At.20733
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42566972 (NM_118110)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein (TIR class), putative (AT4G19920) mRNA, complete cds

DNA Sequence

GGCTGATAAACCAACCAGGCAACGACCAATGGACcctcctagtcctcctcctcctcccattcctgaatcccgaccacgacctcttactcctccCGTGCTCCTAACCCGACCACGACCTCCTCTTCCTTATGCTCGCCCTCTTCAGCCACCGCAAAGTCTTCCACCCCGACCACGACCCCAGGTGTTTGTTAGTTTCCGAGGAAAGGAGCTGCGCCACGGCTTCGTGAGTCATGTAGTGAAAGCCTTGAGAATTGCAGGGGTCAACGTTTTCATTGATAGCAACGAGATGAAAGGGAGAGACCTTCAAAACCTCTTCAAGAGAATCGAAAACTCAAAGATGGCACTCGTGATCTTCTCTGACCGGTTCTCGGAGTCAGACTGGTGCTTAAACGAGCTCGTGAAGATTGATGATTGCGTGAAGGAAGGGAAACTAACAGTGATCCCTGTCTTCTACAGGGTCAATACAGACGACGTGAAAAATTTCAAAGGTAAATTTGGAAGTTGTTTTATAGAAACGGTGCAGAGACAGTCTCCTAAGGAGGAACCTATGGCCGAACGTTGGGTGAACTCTGTGAAATCTATTTCGTCCAAGACCGGCTTCACCTCAGAAGTCCACAGAATAGATAGCTATCTTGTGGATGCGATTGTTCGGGACGTTAAGAGACAGCTACCATACGTTCCCACTAAAGAGAAGGAATTGCCCATTGAAACAGAGATTTTCTTCGCTCTTGTTTTGGCTGGTCTCTGTAATTTCATAGCACCTTTAATATTCAATGACACGAGTTTCTACAAGACTCCTCAATGGTTTGTAGGTGTTTTGTTTTTGGTTCTAATCCGCAGGAAGTTCGCCTGACCGTGTGAGTGATCGCGTGCTTTGACATGATCAGGCTcgtgtttgtacttgtacatgtgtgtgttttgtgtgtttgtTAATATTTATATATAAAGAAAATGTGCATAATTTACCCATATATATGCATTACCCGCTTTTCATGCCTGTGTGAGTTGGAATATGTGTAACTGTTAAG


Protein sequences

Name Description Sequence
At.20733 translated coding region predicted by ESTScan from UniGene At.20733

XADKPTRQRPMDPPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRPRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFTSEVHRIDSYLVDAIVRDVKRQLPYVPTKEKELPIETEIFFALVLAGLCNFIAPLIFNDTSFYKTPQWFVGVLFLVLIRRKFA

Domains

Domain Start-End Description Sequence

Seg: seg
5-61 seg

PTRQRPMDPPSPPPPPIPESRPRPLTPPVLLTRPRPPLPYARPLQPPQSLPPRPRPQ

superfamily: SSF52200
IPR000157
48-201 Toll/Interleukin receptor TIR domain
Toll-Interleukin receptor

LQPPQSLPPRPRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGF

ProfileScan: PS50104
IPR000157
58-198 TIR
Toll-Interleukin receptor

PRPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSK

HMMSmart: SM00255
IPR000157
59-198 Toll
Toll/interleukin-1 receptor homology (TIR) domain

RPQVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSK

Gene3D: G3DSA:3.40.50.10140
61-193 no description

QVFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVK

HMMPfam: PF01582
IPR000157
62-190 TIR
Toll-Interleukin receptor

VFVSFRGKELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVN

HMMPanther: PTHR23155:SF66
69-202 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

KELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFT

HMMPanther: PTHR23155
69-202 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KELRHGFVSHVVKALRIAGVNVFIDSNEMKGRDLQNLFKRIENSKMALVIFSDRFSESDWCLNELVKIDDCVKEGKLTVIPVFYRVNTDDVKNFKGKFGSCFIETVQRQSPKEEPMAERWVNSVKSISSKTGFT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox