PRGDB00066017 (At.20832)

From PRG Wiki
Jump to: navigation, search
At.20832
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 79327142 (NM_001036766)
Gene Class N
Domain Type NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ABC transporter family protein (AT5G06530) mRNA, complete cds

DNA Sequence

TTCCCCAAAGGTATCGATTCTATATCCTAAGAAAAAATCATACCCATCTTCTTATAGTCATTCCTGtttttttttcttttctattttATGTCTGTTCATTTGTTTATGTTCCATATATACATACATATAAGTTCTATATATGATCTCGAACGTATATATTGGTTATAAATTTTGGCTAAAGATTATGATTTTTGGTCGACAGTTTTTGAAAAGGTCAAAATGTCAATGGAGAAGCCACCTTTGGCCTCCGGTTTAGCTCGAACACGATCGGAGCAGCTATATGAGACGGTTGCAGCAGACATAAGGTCACCTCACGGCTCCATGGACGCTAATGGTGTGCCTGCGACGGCTCCAGCAGCCGTTGGAGGAGGAGGAACGTTGTCGAGGAAATCAAGCCGGAGGTTGATGGGGATGTCTCCGGGGAGGAGTAGCGGCGCCGGAACACACATAAGGAAGTCTAGGAGCGCTCAGCTTAAGCTCGAGCTAGAGGAAGTGAGTAGCGGCGCAGCTTTGAGCCGTGCGTCTAGCGCATCGCTCGGTCTTTCATTTTCCTTCACCGGGTTTGCTATGCCGCCGGAGGAAATCTCCGACTCTAAACCGTTCAGCGACGACGAGATGATACCCGAAGATATTGAAGCGGGAAAGAAGAAGCCTAAGTTTCAAGCAGAACCAACATTGCCCATCTTTCTCAAGTTCAGGGATGTTACATACAAAGTGGTGATCAAGAAATTGACTTCATCTGTGGAGAAAGAGATATTAACTGGGATAAGTGGGAGTGTGAATCCTGGTGAAGTTCTTGCTCTCATGGGACCCTCAGGGAGTGGCAAAACAACTCTTCTTAGCTTACTTGCTGGTCGAATCTCTCAATCCTCTACTGGAGGCTCTGTTACTTACAACGACAAGCCTTACTCTAAATACTTGAAAAGCAAGATTGGGTTTGTGACTCAAGATGATGTTCTGTTTCCTCATCTTACCGTGAAAGAAACGCTAACCTATGCTGCTCGTCTGCGCTTACCCAAGACTCTTACGAGAGAGCAGAAGAAGCAACGAGCTTTAGACGTTATCCAAGAGTTGGGTTTAGAGAGATGCCAAGACACTATGATTGGTGGAGCATTCGTGCGTGGTGTATCAGGTGGAGAGAGGAAAAGAGTTTCTATTGGAAACGAGATCATCATTAATCCTTCTCTATTACTTCTTGATGAACCAACCTCTGGTTTAGATTCCACCACTGCTCTTAGAACCATTCTGATGCTCCATGACATCGCCGAGGCGGGGAAAACCGTGATCACAACGATACATCAGCCCTCGAGTAGGCTCTTCCATAGGTTTGACAAGCTGATTCTACTAGGAAGAGGAAGTCTTCTCTACTTTGGAAAATCATCAGAAGCTTTAGATTACTTCTCTTCCATTGGATGCTCTCCTCTTATCGCCATGAATCCTGCAGAGTTCTTGCTCGATCTTGCCAACGGTAACATCAACGATATCTCTGTACCTTCTGAGTTAGATGATAGAGTTCAAGTTGGCAATTCAGGTAGAGAAACTCAAACTGGCAAGCCATCTCCTGCTGCTGTTCATGAGTATCTAGTGGAGGCCTACGAGACTAGGGTTGCAGAACAGGAGAAGAAGAAACTATTGGATCCTGTGCCACTCGATGAAGAAGCTAAGGCCAAAAGTACGCGTCTAAAGCGCCAATGGGGAACGTGCTGGTGGGAGCAATATTGCATACTATTCTGCAGAGGACTCAAAGAACGGCGACACGAATACTTCAGTTGGTTGCGTGTTACGCAAGTTCTTTCCACAGCTGTCATTTTAGGTCTTCTCTGGTGGCAGTCGGACATTAGGACTCCAATGGGACTACAAGATCAGGCTGGTTTGCTCTTCTTCATAGCAGTTTTTTGGGGATTCTTCCCTGTTTTCACAGCGATCTTTGCGTTTCCGCAAGAGCGAGCGATGTTAAATAAGGAGAGAGCAGCGGATATGTACAGATTAAGCGCATATTTCCTAGCTCGAACCACGAGTGATCTCCCTCTCGACTTTATTCTACCTTCTCTCTTCCTTCTTGTCGTCTATTTCATGACAGGTCTTCGGATCAGCCCATATCCCTTCTTCTTGAGCATGCTCACAGTTTTCCTTTGCATCATCGCAGCTCAGGGACTCGGACTTGCAATTGGTGCCATTTTAATGGATTTAAAGAAGGCTACGACTTTGGCTTCAGTAACTGTCATGACATTCATGCTCGCCGGAGGATTCTTCGTCAAGGCAAGTCCTCTGTTTCTTGATTTCCTCTGTTTTTAACTTCCCCTGTTTCTTGATTTCCCCTGTTTTACTGATTTCCTTTTCTGTGTCTACACAGAAAGTGCCGGTTTTCATATCGTGGATACGTTATCTATCTTTCAATTACCACACCTACAAGCTTCTTCTTAAAGTACAATATCAGGACTTCGCTGTGTCCATCAACGGGATGAGAATAGACAACGGACTAACTGAAGTAGCCGCACTCGTTGTCATGATATTCGGTTATCGCCTCCTCGCGTATCTGTCTCTAAGGCAAATGAAGATCGTAACATAACCCATTTTCCACACGAAGAAATCAAATAACATAGAAGAAGCATAAAAAGAGTGCATCAGATCTTGATGATCTTGACACGACCAATCCTTGACAATGATTAAGAGATTGGTCCTAAGATTATTCTTGCTTAATTACAAAGGTGTTGTGAGTTTGATAATGATTGGATGGTGATAGATGTCTTGATTGGAGATAAATATATATGTTCAAGTTTGTAATTGTAGTTCGAATCTAAAATTGGTTAAAGTTTATTAACAAGAAGAACCTTGTGGCTGGATCTGATCTTCTTAAATTCCAATCCAATTATTCTTAGTAT


Protein sequences

Name Description Sequence
At.20832 translated coding region predicted by ESTScan from UniGene At.20832

MEKPPLASGLARTRSEQLYETVAADIRSPHGSMDANGVPATAPAAVGGGGTLSRKSSRRLMGMSPGRSSGAGTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPPEEISDSKPFSDDEMIPEDIEAGKKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNINDISVPSELDDRVQVGNSGRETQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFMLAGGFFVKASPLFLDFLCF

Domains

Domain Start-End Description Sequence

Seg: seg
37-51 seg

GVPATAPAAVGGGGT

Seg: seg
91-114 seg

SSGAALSRASSASLGLSFSFTGFA

HMMPanther: PTHR19241:SF23
115-677 ATP-BINDING CASSETTE TRANSPORTER,ATP-BINDING CASSETTE TRANSPORTER

MPPEEISDSKPFSDDEMIPEDIEAGKKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNINDISVPSELDDRVQVGNSGRETQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFMLAGGFFV

HMMPanther: PTHR19241
115-677 FAMILY NOT NAMED,ATP-BINDING CASSETTE TRANSPORTER

MPPEEISDSKPFSDDEMIPEDIEAGKKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNINDISVPSELDDRVQVGNSGRETQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFMLAGGFFV

superfamily: SSF52540
134-387 P-loop containing nucleoside triphosphate hydrolases

EDIEAGKKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSE

ProfileScan: PS50893
IPR003439
155-401 ABC_TRANSPORTER_2
ABC transporter-like

LKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLI

Gene3D: G3DSA:3.40.50.300
155-391 no description

LKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDY

HMMSmart: SM00382
IPR003593
187-378 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

PGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLILLGRGS

Seg: seg
195-210 seg

GPSGSGKTTLLSLLAG

HMMPfam: PF00005
IPR003439
202-329 ABC_tran
ABC transporter-like

TTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTS

PatternScan: PS00211
IPR017871
301-315 ABC_TRANSPORTER_1
ABC transporter, conserved site

VSGGERKRVSIGNEI

HMMPfam: PF01061
IPR013525
497-678 ABC2_membrane
ABC-2 type transporter

QYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFMLAGGFFVK

Seg: seg
636-652 seg

LCIIAAQGLGLAIGAIL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox