PRGDB00066018 (At.20838)

From PRG Wiki
Jump to: navigation, search
At.20838
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186489426 (NM_103718)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana serine

DNA Sequence

GTTTTAAAAGTGTTAAAGACGATCATTCATCATCAACACTAACACTTTTTCAAATTGTCGTCTAAAGTCTCTAAAACCACCATCGAAGTCTTGACAGAGAGAATTCGAATCGGACAGAGAATTTCTTCCGTAGTTTTTCTTGTAAGCGAAAAAGAAGTTTAGTTAGCTCGTGTGAGAGAAGGGTGTAATGAGCTGTTTTGGTTGGTGTGGGAGTGAGGATTTTCGCAACGCTACTGACACTGGCCCAAGGCCAGCGCATAACCCAGCAGGTTACAATGGAGGCCACTACCAAAGAGCTGATCCACCCATGAACCAGCCTGTTATTCCCATGCAGCCTATTTCTGTACCAGCCATTCCAGTGGATGAGCTGAGAGATATAACTGATAACTATGGTTCAAAGACCTTGATCGGCGAGGGTTCTTATGGAAGAGTGTTTTATGGTGTTCTTAAAAGCGGTGGTGCAGCTGCCATCAAGAAACTTGACTCTAGTAAGCAGCCAGATCAAGAATTTCTTTCCCAGATATCAATGGTTTCGAGATTGCGACATGACAATGTTACTGCACTTATGGGCTATTGTGTTGATGGCCCTCTCCGTGTTCTTGCTTATGAATTTGCTCCTAAAGGATCTCTTCATGATACTCTTCATGGCAAAAAAGGTGCCAAAGGAGCACTTAGAGGTCCTGTTATGACGTGGCAACAGAGAGTCAAAATCGCCGTTGGTGCGGCCAGAGGACTTGAGTACTTGCATGAGAAGGTGAGCCCTCAGGTTATCCACCGAGACATCAAATCCAGCAACGTACTTCTGTTTGATGATGATGTTGCCAAAATTGGTGATTTTGATCTGTCTGATCAAGCCCCTGACATGGCTGCTCGCCTTCACTCAACTCGTGTGCTAGGAACCTTTGGCTACCACGCTCCAGAATATGCAATGACAGGAACGTTGAGCTCAAAGAGCGATGTGTACAGTTTTGGCGTTGTTCTGCTGGAGCTCCTAACTGGTCGTAAACCAGTCGATCATACCTTACCGCGTGGACAACAAAGTCTAGTGACATGGGCAACCCCTAAACTAAGTGAAGACAAAGTGAAGCAATGCGTTGATGCAAGACTACTCGGAGAGTACCCTCCCAAAGCTGTTGGCAAGCTAGCTGCAGTGGCTGCACTCTGTGTGCAATATGAGGCAAATTTCAGACCAAACATGAGCATTGTGGTGAAGGCACTTCAACCTCTTTTAAACCCTCCTCGTTCTGCTCCGCAGACTCCACATAGGAACCCCTACTGATCAAATATTCAATCCCCCATATCTCATCTTCTGATCATGATGATTCATCAAATGTGTATTATTCATTTTGGTTCTGTATTGTGTAAATTTATGGGACCTTATCTCATTAACTCTTCATTCTCAAGTCCCACTTTTCAAGACATGTGTATGTCTCTCCTCTATATCAATATATTTTATGTTTTCCTGTGA


Protein sequences

Name Description Sequence
At.20838 translated coding region predicted by ESTScan from UniGene At.20838

MSCFGWCGSEDFRNATDTGPRPAHNPAGYNGGHYQRADPPMNQPVIPMQPISVPAIPVDELRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLNPPRSAPQTPHRNPY

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-362 PTHR24420,FAMILY NOT NAMED

MSCFGWCGSEDFRNATDTGPRPAHNPAGYNGGHYQRADPPMNQPVIPMQPISVPAIPVDELRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLNPPRSAPQTPHRNP

HMMPanther: PTHR24420:SF870
1-362 PTHR24420:SF870

MSCFGWCGSEDFRNATDTGPRPAHNPAGYNGGHYQRADPPMNQPVIPMQPISVPAIPVDELRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLNPPRSAPQTPHRNP

superfamily: SSF56112
IPR011009
38-352 Kinase_like
Protein kinase-like domain

DPPMNQPVIPMQPISVPAIPVDELRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLLNPPR

Gene3D: G3DSA:3.30.200.20
53-142 G3DSA:3.30.200.20

VPAIPVDELRDITDNYGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEF

ProfileScan: PS50011
IPR000719
68-348 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YGSKTLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
72-344 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

TLIGEGSYGRVFYGVLKSGGAAAIKKLDSSKQPDQEFLSQISMVSRLRHDNVTALMGYCVDGPLRVLAYEFAPKGSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKAL

PatternScan: PS00107
IPR017441
74-97 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVFYGVLKSGGAAAIKK

Gene3D: G3DSA:1.10.510.10
146-343 G3DSA:1.10.510.10

GSLHDTLHGKKGAKGALRGPVMTWQQRVKIAVGAARGLEYLHEKVSPQVIHRDIKSSNVLLFDDDVAKIGDFDLSDQAPDMAARLHSTRVLGTFGYHAPEYAMTGTLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLLGEYPPKAVGKLAAVAALCVQYEANFRPNMSIVVKA

PatternScan: PS00108
IPR008271
194-206 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox