PRGDB00066020 (At.20959)

From PRG Wiki
Jump to: navigation, search
At.20959
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 240256080 (NM_118787)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana kinase (AT4G26540) mRNA, complete cds

DNA Sequence

AAAACCAAAACCGATGGATTGGTTCTTCGCTTTACAATCCCAACGCACTTCTCTCATTCTTCTTCCTCATCTTCGTCTTCTCCGATGCCACCAAATatctatagactctccttcttctcatccctactctgtttcttcttcatcccctgtttctctctcGACCAACAAGGTCAAGCTCTCTTGTCATGGAAGTCTCAACTGAACATCTCCGGCGACGCTTTTTCCTCCTGGCACGTCGCCGACACATCTCCCTGCAATTGGGTCGGCGTAAAATGTAACCGTAGAGGTGAAGTTTCGGAGATACAGCTCAAAGGTATGGACTTGCAAGGTTCTCTGCCGGTGACTAGTCTCCGGAGCCTCAAGTCTCTTACTTCCCTCACTTTATCTTCACTGAATCTCACCGGAGTAATCCCCAAGGAGATCGGAGACTTCACGGAGCTTGAGTTACTCGATTTGTCGGATAATTCTCTCTCCGGTGATATCCCTGTGGAAATCTTCAGGCTCAAGAAACTCAAGACTCTGTCTCTGAACACTAACAATCTAGAAGGTCATATTCCGATGGAGATTGGGAATCTTTCGGGTCTCGTAGAGCTTATGCTTTTCGACAACAAGCTATCCGGAGAGATCCCAAGGAGTATCGGAGAGCTCAAGAATCTACAAGTCTTACGTGCTGGTGGGAACAAGAATCTAAGAGGTGAGCTTCCTTGGGAGATAGGTAACTGCGAGAATCTTGTAATGCTTGGTCTCGCTGAGACTAGTCTCTCCGGGAAACTTCCGGCGTCGATTGGAAACCTGAAACGTGTTCAGACAATAGCAATTTACACGTCACTCTTGTCTGGTCCAATTCCGGATGAGATTGGATACTGCACAGAGCTCCAAAACCTCTACTTGTATCAGAATTCAATCTCAGGATCGATCCCTACCACCATTGGAGGTTTAAAGAAGCTGCAGAGTCTACTTTTATGGCAGAACAATCTCGTTGGGAAAATCCCAACCGAGCTTGGGAACTGTCCCGAGCTCTGGCTTATCGATTTTTCCGAGAATCTCCTCACCGGGACCATCCCAAGGAGCTTCGGAAAACTTGAGAATCTACAAGAGCTTCAGCTGAGTGTAAACCAGATCTCAGGAACAATCCCTGAAGAGCTAACGAATTGCACGAAGCTGACGCATTTAGAGATCGACAATAATCTCATCACAGGAGAGATTCCGTCATTGATGAGTAACCTAAGAAGCTTAACCATGTTCTTCGCATGGCAGAACAAGTTAACTGGAAACATCCCTCAAAGTCTCTCCCAGTGTCGTGAGCTTCAAGCCATCGATCTCTCTTACAACAGTCTCTCTGGCTCCATCCCAAAAGAGATATTCGGGTTACGAAACCTCACGAAGCTTCTTCTTCTCTCCAATGATTTGTCGGGTTTCATACCTCCGGATATTGGAAACTGTACGAATCTTTACCGGTTAAGACTCAACGGTAACAGACTCGCCGGAAGTATCCCGTCGGAAATCGGGAATCTGAAAAATCTCAACTTTGTTGATATAAGTGAGAACCGTCTCGTCGGGTCAATCCCTCCGGCGATCTCTGGTTGTGAAAGCCTCGAGTTTCTCGATCTTCACACGAATAGTCTCTCCGGTTCATTGCTCGGTACTACACTCCCAAAGAGCTTGAAGTTCATCGATTTCTCCGATAATGCTCTGTCCAGTACTCTGCCTCCGGGAATAGGATTGTTGACAGAGCTTACAAAGCTCAATCTCGCCAAGAACAGATTATCCGGCGAAATCCCTAGAGAAATCTCCACTTGTCGGAGTCTACAGCTTCTCAATCTCGGCGAAAATGACTTTTCTGGTGAAATCCCTGACGAATTGGGTCAAATCCCGTCTCTGGCGATATCTCTTAATCTCAGCTGCAATAGGTTCGTCGGAGAAATCCCGTCTAGATTCTCCGACTTGAAAAACCTTGGAGTGCTCGACGTATCTCACAACCAACTCACCGGAAACTTAAACGTTTTAACGGATTTGCAAAACCTCGTCTCTCTCAACATCTCCTACAACGATTTCTCCGGCGATTTACCCAACACGCCCTTTTTCCGGCGACTTCCACTTTCTGATCTCGCCTCAAACAGAGGGCTTTACATCTCGAACGCAATCTCGACCCGACCCGACCCGACGACCAGGAACAGCTCCGTCGTTAGATTGACTATTTTAATTCTCGTCGTCGTCACTGCCGTACTTGTTCTCATGGCGGTTTACACTCTAGTCCGGGCAAGAGCCGCCGGAAAACAACTCCTCGGAGAAGAAATAGATTCGTGGGAAGTGACGCTTTACCAAAAACTCGATTTTTCAATCGACGACATTGTTAAGAATCTGACGTCAGCAAACGTGATCGGAACCGGAAGCTCCGGTGTGGTTTACCGTATAACGATTCCCTCCGGCGAGTCACTCGCGGTGAAGAAAATGTGGTCAAAGGAAGAGAGTGGTGCGTTTAACTCCGAGATTAAAACTCTAGGATCGATTCGTCACAGAAACATCGTTCGTCTTCTTGGTTGGTGCTCTAATCGGAATCTGAAACTCTTGTTCTACGACTATCTCCCTAACGGTAGCTTGAGTTCTCGGCTTCACGGCGCCGGAAAAGGAGGATGTGTTGATTGGGAGGCGCGATACGACGTCGTTCTTGGTGTGGCCCATGCACTTGCTTATCTCCACCATGATTGTCTCCCCACAATTATACATGGTGACGTTAAAGCTATGAATGTCTTATTGGGTCCTCACTTTGAACCCTACTTAGCTGATTTCGGTTTAGCTAGAACCATCTCCGGTTATCCAAATACCGGAATCGATTTAGCGAAACCCACCAATCGGCCTCCGATGGCTGGCTCCTATGGTTACATGGCTCCAGAACATGCTTCGATGCAACGTATTACCGAGAAGAGCGATGTTTATAGTTACGGGGTGGTATTGTTAGAGGTTTTAACCGGAAAGCATCCGTTAGATCCGGATCTACCAGGAGGTGCACATTTGGTTAAGTGGGTGAGAGATCACTTGGCTGAGAAAAAAGATCCTAGCAGGCTTCTTGATCCGAGACTCGATGGACGGACTGACTCGATAATGCATGAGATGCTTCAAACTCTTGCGGTTGCGTTCTTGTGTGTTAGCAACAAGGCAAACGAACGACCTTTAATGAAAGATGTTGTGGCAATGCTCACAGAAATAAGGCATATTGATGTTGGAAGATCGGAGACAGAGAAGATCAAAGCTGGTGGTTGCGGAAGCAAAGAGCCACAACAATTTATGTCGAATGAGAAAATCATCAATTCTCACGGTTCGTCTAATTGTTCATTTGCGTTTTCGGATGACTCCGTTTAAAAAAGGAACAAGGTAACAAATGTAAACCGTGAGCTATTGTTTACAAAGCTGTGTGAATATATATGCTTTTGTTGGAGCTTTAAATTTTTTGGAAGTTTTTGTATAATCAATTACAACTACAGTTGCAATAGATTTTAGTGATTTGTTCCTG


Protein sequences

Name Description Sequence
At.20959 translated coding region predicted by ESTScan from UniGene At.20959

KTKTDGLVLRFTIPTHFSHSSSSSSSSPMPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDAFSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVVVTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSETEKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF736
18-1119 SUBFAMILY NOT NAMED

SHSSSSSSSSPMPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDAFSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVVVTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSETEKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV

HMMPanther: PTHR24420
18-1119 FAMILY NOT NAMED,FAMILY NOT NAMED

SHSSSSSSSSPMPPNIYRLSFFSSLLCFFFIPCFSLDQQGQALLSWKSQLNISGDAFSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFSGDLPNTPFFRRLPLSDLASNRGLYISNAISTRPDPTTRNSSVVRLTILILVVVTAVLVLMAVYTLVRARAAGKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDVGRSETEKIKAGGCGSKEPQQFMSNEKIINSHGSSNCSFAFSDDSV

Seg: seg
18-27 seg

SHSSSSSSSS

Seg: seg
36-53 seg

LSFFSSLLCFFFIPCFSL

Gene3D: G3DSA:3.80.10.10
54-335 no description

DQQGQALLSWKSQLNISGDAFSSWHVADTSPCNWVGVKCNRRGEVSEIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELG

HMMPfam: PF08263
IPR013210
54-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DQQGQALLSWKSQLNISGDAFSSWHVADTSPCNWVGVKCN

superfamily: SSF52047
100-399 RNI-like,LRR

EIQLKGMDLQGSLPVTSLRSLKSLTSLTLSSLNLTGVIPKEIGDFTELELLDLSDNSLSGDIPVEIFRLKKLKTLSLNTNNLEGHIPMEIGNLSGLVELMLFDNKLSGEIPRSIGELKNLQVLRAGGNKNLRGELPWEIGNCENLVMLGLAETSLSGKLPASIGNLKRVQTIAIYTSLLSGPIPDEIGYCTELQNLYLYQNSISGSIPTTIGGLKKLQSLLLWQNNLVGKIPTELGNCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLIT

Seg: seg
115-134 seg

TSLRSLKSLTSLTLSSLNLT

HMMSmart: SM00369
IPR003591
144-168 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FTELELLDLSDNSLSGDIPVEIFRL

HMMSmart: SM00365
144-159 Leucine-rich repeat, SDS22-like subfamily

FTELELLDLSDNSLSG

Seg: seg
146-158 seg

ELELLDLSDNSLS

HMMPfam: PF00560
IPR001611
147-166 LRR_1
Leucine-rich repeat

LELLDLSDNSLSGDIPVEIF

Seg: seg
168-181 seg

LKKLKTLSLNTNNL

HMMSmart: SM00365
168-194 Leucine-rich repeat, SDS22-like subfamily

LKKLKTLSLNTNNLEGHIPMEIGNLSG

HMMSmart: SM00369
IPR003591
192-216 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSGLVELMLFDNKLSGEIPRSIGEL

HMMSmart: SM00365
289-315 Leucine-rich repeat, SDS22-like subfamily

CTELQNLYLYQNSISGSIPTTIGGLKK

HMMSmart: SM00369
IPR003591
313-337 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKKLQSLLLWQNNLVGKIPTELGNC

Gene3D: G3DSA:3.80.10.10
336-544 no description

NCPELWLIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLITGEIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSG

HMMPfam: PF13855
342-398 LRR_8,Leucine rich repeat

LIDFSENLLTGTIPRSFGKLENLQELQLSVNQISGTIPEELTNCTKLTHLEIDNNLI

HMMSmart: SM00369
IPR003591
361-385 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LENLQELQLSVNQISGTIPEELTNC

HMMSmart: SM00365
361-384 Leucine-rich repeat, SDS22-like subfamily

LENLQELQLSVNQISGTIPEELTN

HMMSmart: SM00365
385-411 Leucine-rich repeat, SDS22-like subfamily

CTKLTHLEIDNNLITGEIPSLMSNLRS

superfamily: SSF52047
401-686 RNI-like,LRR

EIPSLMSNLRSLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDLSGFIPPDIGNCTNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSLSGSLLGTTLPKSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFS

HMMPfam: PF13855
411-470 LRR_8,Leucine rich repeat

SLTMFFAWQNKLTGNIPQSLSQCRELQAIDLSYNSLSGSIPKEIFGLRNLTKLLLLSNDL

Seg: seg
457-471 seg

LRNLTKLLLLSNDLS

HMMSmart: SM00369
IPR003591
457-481 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRNLTKLLLLSNDLSGFIPPDIGNC

HMMPfam: PF13855
482-542 LRR_8,Leucine rich repeat

TNLYRLRLNGNRLAGSIPSEIGNLKNLNFVDISENRLVGSIPPAISGCESLEFLDLHTNSL

Seg: seg
483-494 seg

NLYRLRLNGNRL

HMMSmart: SM00369
IPR003591
505-529 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLNFVDISENRLVGSIPPAISGC

Seg: seg
541-556 seg

SLSGSLLGTTLPKSLK

Gene3D: G3DSA:3.80.10.10
553-699 no description

KSLKFIDFSDNALSSTLPPGIGLLTELTKLNLAKNRLSGEIPREISTCRSLQLLNLGENDFSGEIPDELGQIPSLAISLNLSCNRFVGEIPSRFSDLKNLGVLDVSHNQLTGNLNVLTDLQNLVSLNISYNDFSGDLPNTPFFRRLP

HMMSmart: SM00369
IPR003591
576-600 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTELTKLNLAKNRLSGEIPREISTC

HMMSmart: SM00365
576-599 Leucine-rich repeat, SDS22-like subfamily

LTELTKLNLAKNRLSGEIPREIST

HMMSmart: SM00365
649-677 Leucine-rich repeat, SDS22-like subfamily

LKNLGVLDVSHNQLTGNLNVLTDLQNLVS

HMMSmart: SM00369
IPR003591
649-672 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLGVLDVSHNQLTGNLNVLTDL

HMMPfam: PF13516
672-688 LRR_6,Leucine Rich repeat

LQNLVSLNISYNDFSGD

Seg: seg
728-752 seg

VVRLTILILVVVTAVLVLMAVYTLV

superfamily: SSF56112
IPR011009
758-1066 Protein kinase-like (PK-like)
Protein kinase-like domain

GKQLLGEEIDSWEVTLYQKLDFSIDDIVKNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAML

Gene3D: G3DSA:3.30.200.20
786-847 no description

KNLTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLG

ProfileScan: PS50011
IPR000719
788-1074 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAMLTEIRHIDV

HMMSmart: SM00220
IPR002290
788-1039 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEML

HMMSmart: SM00219
IPR020635
788-1066 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LTSANVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPGGAHLVKWVRDHLAEKKDPSRLLDPRLDGRTDSIMHEMLQTLAVAFLCVSNKANERPLMKDVVAML

HMMPfam: PF00069
IPR017442
792-1001 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NVIGTGSSGVVYRITIPSGESLAVKKMWSKEESGAFNSEIKTLGSIRHRNIVRLLGWCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDPDLPG

PatternScan: PS00107
IPR017441
794-817 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGTGSSGVVYRITIPSGESLAVKK

Gene3D: G3DSA:1.10.510.10
848-997 no description

WCSNRNLKLLFYDYLPNGSLSSRLHGAGKGGCVDWEARYDVVLGVAHALAYLHHDCLPTIIHGDVKAMNVLLGPHFEPYLADFGLARTISGYPNTGIDLAKPTNRPPMAGSYGYMAPEHASMQRITEKSDVYSYGVVLLEVLTGKHPLDP

PatternScan: PS00108
IPR008271
907-919 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHGDVKAMNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox