PRGDB00066021 (At.20987)

From PRG Wiki
Jump to: navigation, search
At.20987
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 42570533 (NM_180530)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein

DNA Sequence

ATCTCTTGTTGCTCCTTGTATTAGCCCATCATTTTTTTATTTCTCCTGCGAATTCTCCGCCATAGATTTTCTTTTGAATTTCTCCTGCTAACTCTTGAGCTCCCCAAAGGCGGCTACATCGGTTTTGTCACCTCTACTCGCTCACTTTTCTCCGTCCAATTTTGCAGCTTTTGAAGATCAAGAGGTGAACATTCGGAGTGATGAATCGGCCAAAGGTTCAGCGTCGTGTTGGAAAGTATGAGGTTGGAAAGACGCTTGGACAAGGCACTTTTGCGAAAGTTCGGTGTGCTGTTAATACTGAGACAGGAGAACGCGTGGCTCTCAAAATACTTGATAAGGAGAAGGTTCTTAAGCATAAGATGGCTGAACAGATAAGGAGAGAAATTTGTACTATGAAGCTGATAAACCATCCAAATGTAGTGCGGCTGTATGAGGTTTTGGCGAGCAAGACTAAGATATATATTGTTCTAGAGTTCGGCACTGGTGGAGAGCTTTTTGACAAAATTGTACATGATGGGCGCTTGAAAGAAGAGAATGCACGGAAATATTTTCAGCAGCTTATTAATGCAGTTGATTACTGCCATAGCAGGGGAGTGTACCACCGGGACTTAAAGCCGGAAAACTTGCTTCTAGATGCTCAAGGAAATCTGAAAGTCTCTGATTTTGGATTGAGTGCGTTGTCCCGACAAGTCAGGGGTGATGGTCTTCTTCACACTGCATGCGGAACTCCAAACTATGCTGCTCCTGAGGTTCTTAATGATCAAGGTTATGACGGGGCAACCGCAGACTTGTGGTCCTGTGGAGTGATACTCTTTGTACTACTTGCTGGCTACTTGCCTTTCGAGGATTCTAATCTCATGACGCTGTATAAAAAGATAATAGCTGGTGAATATCATTGTCCTCCTTGGCTCTCTCCTGGTGCTAAGAACTTGATTGTCCGAATCTTGGATCCAAACCCTATGACTCGTATCACAATTCCAGAGGTTCTGGGAGATGCGTGGTTCAAGAAAAATTACAAGCCAGCTGTTTTCGAGGAGAAGGAAGAAGCCAACTTGGATGATGTGGACGCTGTTTTCAAAGATTCAGAAGAGCATCATGTCACAGAAAAGAAAGAGGAGCAACCAACTTCAATGAATGCCTTTGAGTTGATATCAATGTCGAGAGCTCTGGATCTCGGGAATTTGTTTGAAGAAGAAGAGGGATTCAAGCGAGAAACGAGATTTGCTGCTAAAGGTGCTGCTAATGATTTAGTCCAAAAGATTGAAGAAGCTTCTAAGCCGCTTGGTTTCGATATTCAAAAGAAAAACTATAAGATGAGACTTGAAAACGTGACTGCTGGAAGGAAAGGAAACCTAAGAGTTGCAACTGAGATATTTCAAGTATCACCGTCTCTTCATATGATCGAAGTCCGGAAAACGAAAGGGGATACACTAGAATTCCATAAGTTCTACAAGAAGCTCTCAACCTCACTTAACGATGTGGTTTGGAAATCTGGCGAGAGCTCTGGTCTAAGCAAATAAGAAAAAAGACTGATGATTCAAGTCCTTGCTTTGACTATCTTTTATTTAGCTTTTTGCTGATACTTTCTTTCAAGACTCAATTCTTTTAAATATTAGAGACAAAAAGCCATGAGATTGATGACTCTGTAGATATCGAAGCATGTGCAGTAAGTTTATGCTGTTCATATAATTGCAAACTTCGATTGTGTTGTGTCACAAACATTTTGTCTAACTGGGTTTACTTACTACTATTAATGCTCAAAGATGCTGTAAGAACGTTGAAGT


Protein sequences

Name Description Sequence
At.20987 translated coding region predicted by ESTScan from UniGene At.20987

MNRPKVQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHHVTEKKEEQPTSMNAFELISMSRALDLGNLFEEEEGFKRETRFAAKGAANDLVQKIEEASKPLGFDIQKKNYKMRLENVTAGRKGNLRVATEIFQVSPSLHMIEVRKTKGDTLEFHKFYKKLSTSLNDVVWKSGESSGLSK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-299 Kinase_like
Protein kinase-like domain

MNRPKVQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHH

Gene3D: G3DSA:3.30.200.20
4-120 G3DSA:3.30.200.20

PKVQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQL

HMMPanther: PTHR24345:SF45
5-439 PTHR24345:SF45,SERINE/THREONINE-PROTEIN KINASE PLK1

KVQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHHVTEKKEEQPTSMNAFELISMSRALDLGNLFEEEEGFKRETRFAAKGAANDLVQKIEEASKPLGFDIQKKNYKMRLENVTAGRKGNLRVATEIFQVSPSLHMIEVRKTKGDTLEFHKFYKKLSTSLNDVVWKSGESSGLSK

HMMPanther: PTHR24345
5-439 PTHR24345,SERINE/THREONINE-PROTEIN KINASE PLK

KVQRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKPAVFEEKEEANLDDVDAVFKDSEEHHVTEKKEEQPTSMNAFELISMSRALDLGNLFEEEEGFKRETRFAAKGAANDLVQKIEEASKPLGFDIQKKNYKMRLENVTAGRKGNLRVATEIFQVSPSLHMIEVRKTKGDTLEFHKFYKKLSTSLNDVVWKSGESSGLSK

HMMPfam: PF00069
IPR017442
13-268 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWF

ProfileScan: PS50011
IPR000719
13-268 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWF

HMMSmart: SM00220
IPR002290
13-268 S_TKc
Serine/threonine-protein kinase domain

YEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHPNVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWF

PatternScan: PS00107
IPR017441
19-42 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGTFAKVRCAVNTETGERVALK

Gene3D: G3DSA:1.10.510.10
121-274 G3DSA:1.10.510.10

INAVDYCHSRGVYHRDLKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCGVILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDAWFKKNYKP

PatternScan: PS00108
IPR008271
132-144 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDLKPENLLL

ProfileScan: PS50816
IPR018451
306-330 NAF
NAF/FISL domain

EQPTSMNAFELISMSRALDLGNLFE

HMMPfam: PF03822
IPR004041
307-367 NAF
NAF domain

QPTSMNAFELISMSRALDLGNLFEEEEGFKRETRFAAKGAANDLVQKIEEASKPLGFDIQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox