PRGDB00066022 (At.21017)

From PRG Wiki
Jump to: navigation, search
At.21017
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30689965 (NM_119586)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat transmembrane protein kinase, putative (AT4G34220) mRNA, complete cds

DNA Sequence

TGCTCCACTATCTCATAGATTTGGTGACCAGAACAACTTATCTCTTGAGTGGTTCAACCTCTATCTCTCTCTCTTTCTGCCATGAAAATGCAAAGCCAAATGTAATAGTTAGAGAGGGAGAAACCAAGAACTGAAAGACCATGACTTCCAACAGAAGCAACCTCCTGTTCTCATTAGTCCTCTTCCACTTTCTTTTTGTCCCCACACAACTCCAAGCTCTTAACACTGATGGTGTTCTTCTGCTTACTTTCAAATACTCCATCCTCACTGACCCTCTCTCTGTTCTACGCAATTGGAACTATGATGATGCAACACCATGCTTGTGGACAGGTGTCACATGTACAGAGCTTGGGAAGCCTAACACACCAGACATGTTCAGAGTCACAAGCTTGGTACTTCCCAACAAACACCTTTTGGGTTCCATCACTCCGGACTTGTTCTCGATTCCATATCTAAGGATCTTGGATCTGTCTAGCAATTTCTTCAACGGGTCACTCCCGGACTCGGTGTTCAACGCCACTGAGCTTCAGAGTATCTCCCTTGGAAGCAACAATCTCTCTGGTGATTTGCCCAAGAGTGTCAACAGTGTGACTAATCTCCAGCTCTTGAATCTCTCAGCTAACGCATTTACTGGCGAAATTCCGCTCAACATCTCACTTCTGAAGAATCTAACGGTCGTTTCCTTGTCAAAAAACACCTTTTCAGGTGATATTCCAAGTGGTTTCGAAGCAGCACAGATTCTTGATCTTTCTTCAAATCTTCTCAACGGCTCTCTTCCCAAGGATTTGGGAGGAAAAAGCCTGCATTACTTGAACTTATCACACAACAAAGTCCTCGGCGAGATTTCTCCAAATTTTGCAGAGAAGTTTCCAGCAAATGCCACAGTCGATCTCTCCTTTAACAACCTCACAGGCCCAATCCCAAGTTCCCTTTCTTTACTTAACCAAAAGGCTGAGTCTTTTTCCGGTAACCAAGAGCTTTGTGGGAAGCCATTGAAGATCCTTTGTTCAATTCCTTCCACTCTTTCAAACCCTCCAAATATCTCTGAAACTACTTCACCAGCAATAGCAGTTAAACCAAGAAGTACAGCTCCAATAAACCCTTTGACAGAAAAACCAAATCAGACAGGAAAAAGCAAGCTAAAGCCAAGCACCATTGCCGCAATCACAGTTGCAGATATAGTTGGTCTAGCTTTCATTGGTCTACTCGTGCTCTACGTATACCAAGTCAGGAAACGCAGAAGGTACCCAGAATCTAGCAAATTTAGCTTCTTCAAGTTCTGTCTGGAGAAAAACGAAGCCAAGAAATCGAAACCAAGCACCACTGAGGTCACAGTCCCAGAATCACCAGAGGCCAAAACGACATGCGGTTCATGCATTATCTTGACCGGAGGAAGGTACGACGAGACATCGACATCAGAGAGCGACGTAGAGAATCAACAAACCGTTCAGGCATTCACTCGAACAGATGGTGGGCAACTGAAGCAGAGCTCCCAAACTCAATTGGTTACAGTCGACGGCGAGACTCGGCTAGATCTAGACACTCTGCTAAAGGCATCTGCTTACATATTGGGAACCACCGGAACCGGGATCGTGTATAAGGCGGTGCTGGAGAACGGCACGGCATTCGCGGTGAGGCGGATCGAGACGGAGAGCTGTGCGGCTGCGAAACCCAAGGAATTCGAGAGGGAGGTTCGTGCCATCGCTAAGCTTCGTCACCCAAATCTCGTCAGAATTCGTGGGTTCTGCTGGGGAGACGACGAGAAACTTCTCATTTCCGATTATGTTCCCAATGGCAGCCTCCTCTGTTTCTTCACCGCCACTAAGGCAAGCTCAAGCTCATCTTCTTCGTCGTCATTACAAAACCCTCTTACTTTTGAAGCACGGCTCAAGATAGCAAGAGGAATGGCTAGAGGACTATCTTACATCAATGAGAAGAAACAAGTGCACGGTAACATCAAGCCCAATAACATTCTCTTGAACGCTGAGAATGAGCCCATCATCACCGATTTAGGGCTAGACCGCCTCATGACACCAGCGCGTGAATCTCACACCACTGGACCAACTTCGAGCTCACCGTACCAGCCACCGGAATGGTCCACAAGCCTGAAACCAAACCCTAAATGGGACGTTTACTCCTTTGGCGTCATACTTTTAGAACTTCTCACAAGCAAAGTGTTCTCGGTAGATCATGATATAGATCAGTTCTCAAACTTATCCGACTCTGCAGCGGAAGAGAATGGCCGGTTCTTGAGGTTAATCGACGGTGCAATTAGGAGTGATGTCGCTCGCCATGAGGATGCTGCAATGGCGTGCTTTAGGTTAGGGATTGAATGTGTCTCTTCCTTGCCTCAGAAGCGACCATCCATGAAAGAATTGGTGCAAGTGTTGGAGAAAATTTGTGTTTTAGTTTGATTTCTTAATTCGTATAGCCTAAGTCGTTTTGGCAATATAGAAAGTTATGTGTTATGTATGTTTTAGATGTGTTGCTTAATGCTTACTTTACCCTCGCATAATACTAACTCTTACTTTAGAGTTTAGAATGTGTTTCACTGTTTTGTT


Protein sequences

Name Description Sequence
At.21017 translated coding region predicted by ESTScan from UniGene At.21017

MTSNRSNLLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISETTSPAIAVKPRSTAPINPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLYVYQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTEVTVPESPEAKTTCGSCIILTGGRYDETSTSESDVENQQTVQAFTRTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKICVLV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF470
1-753 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MTSNRSNLLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISETTSPAIAVKPRSTAPINPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLYVYQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTEVTVPESPEAKTTCGSCIILTGGRYDETSTSESDVENQQTVQAFTRTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKI

HMMPanther: PTHR24420
1-753 FAMILY NOT NAMED,FAMILY NOT NAMED

MTSNRSNLLFSLVLFHFLFVPTQLQALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILCSIPSTLSNPPNISETTSPAIAVKPRSTAPINPLTEKPNQTGKSKLKPSTIAAITVADIVGLAFIGLLVLYVYQVRKRRRYPESSKFSFFKFCLEKNEAKKSKPSTTEVTVPESPEAKTTCGSCIILTGGRYDETSTSESDVENQQTVQAFTRTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKI

Seg: seg
8-20 seg

LLFSLVLFHFLFV

superfamily: SSF52058
25-289 L domain-like,LRR

QALNTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQKAESFSGNQELCGKPLKILC

HMMPfam: PF08263
IPR013210
28-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTC

Gene3D: G3DSA:3.80.10.10
28-269 no description

NTDGVLLLTFKYSILTDPLSVLRNWNYDDATPCLWTGVTCTELGKPNTPDMFRVTSLVLPNKHLLGSITPDLFSIPYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANAFTGEIPLNISLLKNLTVVSLSKNTFSGDIPSGFEAAQILDLSSNLLNGSLPKDLGGKSLHYLNLSHNKVLGEISPNFAEKFPANATVDLSFNNLTGPIPSSLSLLNQ

HMMPfam: PF13855
103-162 LRR_8,Leucine rich repeat

PYLRILDLSSNFFNGSLPDSVFNATELQSISLGSNNLSGDLPKSVNSVTNLQLLNLSANA

Seg: seg
201-212 seg

LDLSSNLLNGSL

HMMPfam: PF00560
IPR001611
220-239 LRR_1
Leucine-rich repeat

SLHYLNLSHNKVLGEISPNF

superfamily: SSF56112
IPR011009
441-756 Protein kinase-like (PK-like)
Protein kinase-like domain

RTDGGQLKQSSQTQLVTVDGETRLDLDTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKICVL

HMMSmart: SM00219
IPR020635
467-750 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

DTLLKASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVL

ProfileScan: PS50011
IPR000719
471-753 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KASAYILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKI

HMMSmart: SM00220
IPR002290
475-755 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YILGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQVLEKICV

HMMPfam: PF00069
IPR017442
477-748 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGFCWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQ

Gene3D: G3DSA:3.30.200.20
477-535 no description

LGTTGTGIVYKAVLENGTAFAVRRIETESCAAAKPKEFEREVRAIAKLRHPNLVRIRGF

Gene3D: G3DSA:1.10.510.10
536-748 no description

CWGDDEKLLISDYVPNGSLLCFFTATKASSSSSSSSSLQNPLTFEARLKIARGMARGLSYINEKKQVHGNIKPNNILLNAENEPIITDLGLDRLMTPARESHTTGPTSSSPYQPPEWSTSLKPNPKWDVYSFGVILLELLTSKVFSVDHDIDQFSNLSDSAAEENGRFLRLIDGAIRSDVARHEDAAMACFRLGIECVSSLPQKRPSMKELVQ

Seg: seg
564-572 seg

SSSSSSSSS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox