PRGDB00066023 (At.21023)

From PRG Wiki
Jump to: navigation, search
At.21023
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30684553 (NM_112631)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana CIPK1 (CBL-INTERACTING PROTEIN KINASE 1); kinase

DNA Sequence

AGAAGAGGAAACAAAGAGAAGTAGCGTCCTCTCTTCAATTTCAACCGGCActttcttctcttcttcttcttcttcccaatcttcctcgtctctttacctacacctatatatatatatatatatatatCTCCTTCCCTCACACACATACCTGCACAGCTACAATAATCTACTTCCCCTCTTTCAATAACGGAATTAATAGTAATCTAATCGGAAGATTCAAGCGAGAAATCGATTTGGTTGTCTGTTAATTTGTTGGGAAATAAATTGAAATAGGAGATTGATTGGATGGTGAGAAGGCAAGAGGAGGAGAAGAAGGCGGAGAAGGGAATGCGTCTGGGGAAATACGAGCTAGGGAGGACGCTCGGCGAGGGTAATTTCGGTAAAGTTAAATTCGCTAAAGATACCGTCTCCGGTCATTCCTTCGCCGTTAAAATCATCGACAAGTCTCGTATCGCCGATCTCAACTTCTCCTTACAGATAAAAAGAGAGATCCGGACTCTGAAAATGTTGAAACATCCCCACATTGTTAGATTACATGAGGTCTTGGCTAGCAAAACGAAAATTAATATGGTAATGGAACTTGTTACCGGAGGAGAATTGTTCGACAGAATTGTTTCCAACGGAAAATTAACAGAAACTGATGGAAGAAAAATGTTTCAGCAGCTTATCGATGGAATCAGCTACTGTCATAGCAAAGGTGTTTTCCACAGGGATCTCAAGCTAGAGAATGTTCTTCTTGATGCAAAGGGACATATAAAGATCACTGATTTTGGCCTCAGTGCTCTGCCTCAGCATTTTAGGGATGACGGATTGTTGCATACAACCTGTGGAAGTCCTAATTACGTTGCGCCTGAGGTTTTAGCTAACAGAGGCTACGATGGTGCAGCATCAGACATATGGTCCTGTGGTGTAATCTTGTATGTGATTCTAACCGGATGTCTTCCTTTCGACGACAGAAACCTTGCAGTTCTTTACCAGAAGATATGTAAAGGAGACCCACCAATACCAAGATGGTTATCCCCGGGTGCAAGAACCATGATTAAGAGAATGCTTGATCCAAATCCAGTCACGAGGATCACAGTTGTGGGTATTAAAGCCAGCGAGTGGTTCAAACTTGAGTACATTCCTTCAATTCCCGATGATGATGACGAAGAAGAAGTTGACACAGACGATGATGCTTTCTCAATCCAAGAACTCGGATCAGAAGAAGGGAAGGGCAGTGATTCACCGACCATCATCAATGCGTTTCAGTTAATCGGAATGTCTTCCTTTCTTGACCTGTCCGGTTTCTTTGAACAAGAGAATGTATCAGAGAGGAGAATAAGATTCACTTCAAATAGCTCAGCAAAAGATTTACTGGAGAAAATCGAAACAGCCGTTACAGAAATGGGATTCAGTGTACAAAAGAAACATGCCAAGTTAAGAGTAAAACAAGAAGAAAGAAACCAGAAAGGTCAAGTTGGTTTATCAGTAACAGCTGAGGTTTTCGAGATAAAGCCGTCACTGAACGTGGTTGAGCTAAGAAAATCTTATGGCGATTCATGTTTATATAGACAGTTGTACGAGAGACTATTAAAAGACGTGGGCACATCCTCGCCGGAGCAAGAGATAGTAACTTAGGTGTTGGTGTTTTCGGCTGAAGAGATATACATAGCTCTAATAATTTATCATATGGAACACACCATCCATGTTCATATAATTTATTATCTTAAGTATATATAAAAGGAGCTCGATTTATATGATTAGTGCAAATAGTAATTGCATTTAAGTATAAACCGTGGCGTAGATCTTTCCTCAAGAATTAGAGATTTTATTCACTACCTTTGTATTTGTTTTTATTATTATTTGGTGTGGCAAATCTGCCTACTAGCAAAAAAGATCCCATAAAAAATCTCTTCATTATTTTTGTAAATAATATACATGTGTTTAGTTTGTATC


Protein sequences

Name Description Sequence
At.21023 translated coding region predicted by ESTScan from UniGene At.21023

MVRRQEEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFSIQELGSEEGKGSDSPTIINAFQLIGMSSFLDLSGFFEQENVSERRIRFTSNSSAKDLLEKIETAVTEMGFSVQKKHAKLRVKQEERNQKGQVGLSVTAEVFEIKPSLNVVELRKSYGDSCLYRQLYERLLKDVGTSSPEQEIVT

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24343
1-347 FAMILY NOT NAMED,SERINE/THREONINE KINASE

MVRRQEEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFSIQELGSEEGKGSDSPTIINAFQLIGMSSFLDLSGFFEQENVSERRIR

HMMPanther: PTHR24343:SF128
1-347 SUBFAMILY NOT NAMED

MVRRQEEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFSIQELGSEEGKGSDSPTIINAFQLIGMSSFLDLSGFFEQENVSERRIR

Gene3D: G3DSA:3.30.200.20
4-116 no description

RQEEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLT

superfamily: SSF56112
IPR011009
6-306 Protein kinase-like (PK-like)
Protein kinase-like domain

EEEKKAEKGMRLGKYELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFSIQELGS

HMMPfam: PF00069
IPR017442
20-275 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWF

ProfileScan: PS50011
IPR000719
20-275 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWF

HMMSmart: SM00220
IPR002290
20-275 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWF

HMMSmart: SM00219
IPR020635
20-275 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YELGRTLGEGNFGKVKFAKDTVSGHSFAVKIIDKSRIADLNFSLQIKREIRTLKMLKHPHIVRLHEVLASKTKINMVMELVTGGELFDRIVSNGKLTETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWF

PatternScan: PS00107
IPR017441
26-49 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGNFGKVKFAKDTVSGHSFAVK

Gene3D: G3DSA:1.10.510.10
117-310 no description

ETDGRKMFQQLIDGISYCHSKGVFHRDLKLENVLLDAKGHIKITDFGLSALPQHFRDDGLLHTTCGSPNYVAPEVLANRGYDGAASDIWSCGVILYVILTGCLPFDDRNLAVLYQKICKGDPPIPRWLSPGARTMIKRMLDPNPVTRITVVGIKASEWFKLEYIPSIPDDDDEEEVDTDDDAFSIQELGSEEGK

PatternScan: PS00108
IPR008271
139-151 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDLKLENVLL

Seg: seg
285-297 seg

DDDDEEEVDTDDD

ProfileScan: PS50816
IPR018451
313-337 NAF
NAF/FISL domain

DSPTIINAFQLIGMSSFLDLSGFFE

HMMPfam: PF03822
IPR004041
314-374 NAF
NAF domain

SPTIINAFQLIGMSSFLDLSGFFEQENVSERRIRFTSNSSAKDLLEKIETAVTEMGFSVQK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox