PRGDB00066024 (At.21066)

From PRG Wiki
Jump to: navigation, search
At.21066
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145340011 (NM_116919)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana MEKK1 (MAP KINASE KINASE KINASE 1); DNA binding

DNA Sequence

ATTATTCCACGAAACACCGCGTTTTTGTTTACAtttcttctctttctctctctctcttctctcatatctctctctTCGCCGTCAGGTTTTGCCCAAATTTCTCGGTCTTCTTCACTCCCGCGAGttttttttCTCGGGAAAATTTTCCAATTCCAAGCTCCATTGAAGCCAAGTAAGAGGTGCGATTCTCTTCAATTTTGACTTGGAACTTGTAAATAGCGTATGGATTTGAGCTGGTTATGGACAGAATTCTAGCTCGTATGAAGAAATCAACTGGACGAAGAGGAGGAGATAAGAATATTACTCCGGTACGGCGGTTAGAGCGTCGCGATGCGGCGAGGAATATCAATTACGACGCAGCTTCATGTTCTAGTTCGTCAGCTGAAGATCTTTCCGTTTCGACTTCTTCGTTGATGACTCGCTCTTTGGAGTTTCCGGAGCCTACTAGTTTCCGAATCGGTGGTGGTGTTGGAGAGATGGATCGGATTTATCGGTCTCTTGGTGTTTCTGGTCCTGATGATTTGGCTATTTCTTTTGATGCTTGGGAAGCTTGTAAGAAACGTTCTTCTTCAGATGTTGTTAATAGGTTTAAGTCTTTTGATCTTGATAAGGTTCGTGATCAGGATTTGAGTGAAGAAGGTCCTAGTGGTGTTGTTGTTGGTTCTGATTCAATGAATCATAAGGTTCAGGGTCAGGATTTGAGTGAAGCAGGTCCTAGTGGTGGAATTGTTACTGAGTTGAGTGAGATTGGGAATTTAATCACTCCTGTGGATAGGTTAGTAGCTGATGGTGTGGTAGAGAATAGGCGTGTTATGGAAAGAACACCAACTATTGTGAAGTCGAAAGGGTATCTTGTACCAAATAATGTAGTGGCTGTTGGTGTTGGTGTTGGTGGTGGTATTAAGGGGCTAAGACCACCAGTACTTAAGCCTCCTCCGGCTATGAAACGACCCCCTATTGATCATCGGGGATCGTCTTGGGATTTCCTGACGCATTTCGCTCCAAGTGAAACAGTTAAGCGGCCGAGTTCCTCTTCTTCTTCTTCCGAGGATGGATGCGATGAAGAGGAAGGCAAGGAAGAGGAAGCGGAAGCGGAAGAGATGGGAGCTAGGTTTATCCAGTTGGGGGATACGGCTGACGAGACGTGCTCATTCACTACAAATGAGGGTGACTCCTCAAGCACAGTATCCAATACTTCGCCTATCTATCCAGATGGAGGAGCTATCATAACGTCTTGGCAAAAGGGTCAACTTTTGGGACGAGGATCATTTGGTTCTGTGTATGAAGGCATTTCTGGAGATGGGGACTTCTTTGCTGTCAAGGAAGTTTCACTTCTTGATCAGGGAAGTCAGGCACAAGAATGCATACAACAACTTGAGGGGGAGATTAAACTACTTAGTCAGCTTCAGCATCAGAATATTGTGAGATATCGTGGCACAGCCAAGGATGGGTCAAACTTGTACATTTTTCTTGAGCTTGTAACCCAAGGGTCCCTTCTAAAACTCTACCAAAGATACCAGCTTCGGGACTCTGTAGTCTCCTTGTACACTAGACAGATTCTTGACGGTTTGAAATATCTCCACGATAAAGGTTTTATTCACAGGGACATCAAATGTGCAAATATATTGGTGGACGCTAATGGCGCCGTCAAACTTGCAGATTTTGGATTGGCAAAGGTTTCAAAGTTTAACGACATTAAGTCCTGCAAGGGAACTCCATTTTGGATGGCTCCAGAGGTTATTAACCGAAAGGATAGTGATGGCTATGGAAGTCCAGCTGATATATGGAGCCTCGGGTGCACTGTGCTGGAAATGTGTACTGGTCAGATCCCCTACTCTGATCTCGAACCCGTTCAAGCCCTGTTTAGGATCGGAAGGGGTACTCTTCCGGAAGTACCTGATACGTTATCACTAGATGCTCGGCTTTTCATACTTAAGTGTCTTAAAGTGAACCCGGAAGAGCGGCCAACTGCAGCTGAACTGCTGAACCATCCATTTGTGAGAAGACCCTTACCATCCGTGGGTTCAGGAGGCTCGGGATCAGCATCTCCCCTTCTCCGTAGATGAGGCTAATTTTAGTAAATTTCCTCAATAGGCATAACCCGAAGATTTATGAGAGATTAGATCCCAGAGAAACTATTGGGAGACACGAGACATGATTCTTCGacacacacacacGTGCGGTCGGGTTGCGCAGCAAGAGCCAAACTTACTTAGTTTCTGTGTCATTCGTTGGTTATTTGTTGCAAGTTATGTGTTGGGCTTGATTTTAAAACTGAAGAGCCTTATTTTTCTAGGAATTAGAAATGTCGACCttggggtttttgggtgtataggttttgtttagttttttttGTTAAATTATAGTGTATGTATGTCTGTATCTATATCATGTAATGTATAATTATAGTTGGTTCTTATAGTTCCTGGCTTGTTGTAACTGTGTACACACATCGATGGGTTTAAGTTCTATTTGTCTCATATTTTAAAG


Protein sequences

Name Description Sequence
At.21066 translated coding region predicted by ESTScan from UniGene At.21066

MDRILARMKKSTGRRGGDKNITPVRRLERRDAARNINYDAASCSSSSAEDLSVSTSSLMTRSLEFPEPTSFRIGGGVGEMDRIYRSLGVSGPDDLAISFDAWEACKKRSSSDVVNRFKSFDLDKVRDQDLSEEGPSGVVVGSDSMNHKVQGQDLSEAGPSGGIVTELSEIGNLITPVDRLVADGVVENRRVMERTPTIVKSKGYLVPNNVVAVGVGVGGGIKGLRPPVLKPPPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSSSEDGCDEEEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPSVGSGGSGSASPLLRR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361
18-608 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

DKNITPVRRLERRDAARNINYDAASCSSSSAEDLSVSTSSLMTRSLEFPEPTSFRIGGGVGEMDRIYRSLGVSGPDDLAISFDAWEACKKRSSSDVVNRFKSFDLDKVRDQDLSEEGPSGVVVGSDSMNHKVQGQDLSEAGPSGGIVTELSEIGNLITPVDRLVADGVVENRRVMERTPTIVKSKGYLVPNNVVAVGVGVGGGIKGLRPPVLKPPPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSSSEDGCDEEEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPSVGSGGSGSASPLLRR

HMMPanther: PTHR24361:SF63
18-608 PTHR24361:SF63

DKNITPVRRLERRDAARNINYDAASCSSSSAEDLSVSTSSLMTRSLEFPEPTSFRIGGGVGEMDRIYRSLGVSGPDDLAISFDAWEACKKRSSSDVVNRFKSFDLDKVRDQDLSEEGPSGVVVGSDSMNHKVQGQDLSEAGPSGGIVTELSEIGNLITPVDRLVADGVVENRRVMERTPTIVKSKGYLVPNNVVAVGVGVGGGIKGLRPPVLKPPPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSSSEDGCDEEEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPSVGSGGSGSASPLLRR

Gene3D: G3DSA:3.30.200.20
298-442 G3DSA:3.30.200.20

TADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILD

superfamily: SSF56112
IPR011009
319-588 Kinase_like
Protein kinase-like domain

TSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVR

HMMPfam: PF00069
IPR017442
333-587 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

WQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFV

ProfileScan: PS50011
IPR000719
333-587 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFV

HMMSmart: SM00220
IPR002290
333-587 S_TKc
Serine/threonine-protein kinase domain

WQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFV

PatternScan: PS00107
IPR017441
339-361 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGSFGSVYEGISGDGDFFAVK

Gene3D: G3DSA:1.10.510.10
443-589 G3DSA:1.10.510.10

GLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRR

PatternScan: PS00108
IPR008271
452-464 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDIKCANILV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox