PRGDB00066025 (At.21094)

From PRG Wiki
Jump to: navigation, search
At.21094
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145334842 (NM_001085298)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase-related (AT5G59010) mRNA, complete cds

DNA Sequence

CGCAGATTCCTTTCTCCTCGAGAACAAAAAAAACTTCtttttttttCTCTTTCTCTCTTGGCTTCTCTTTAGAAAGTGACTCACCAGaaaaaaaaaaGGGTTTTTGCTTTTCGGGTTTAGCTAAGAAAAATCTTTCAATCTTCCTTAAATCTTTCAAAACCCCAAAATGGGACCTCGTTGCTCTAAGCTCTCTCTCTGTTGGTGGCCGACCCATCTCAAATCAACTCACAACGAAGCTTCTGATCTAGGTGATAACAACTTCTTCTTCACTTAAAGTCTCTACCTTTCACACTCTCTCTGCTAACAAAGTTTGAGttttttgttttttGTTCTGATAGATAACGGAACGGACGATTTGCCGTCGTTTACGGAGTTTAGTTTCGACCAACTACGAGCTGCTACTTGTGGATTCTCTACAGACAGTATTGTCTCCGAACATGGTGTTAAAGCTCCTAATGTTGTGTATAAAGGCAGACTTGAAGATGACCGATGGATCGCTGTTAAACGATTCAATAGATCCGCTTGGCCTGATACTCGTCAATTTCTTGAAGAAGCAAAAGCTGTGGGGCAGTTGAGGAATGAGAGGTTGGCGAATTTGATTGGATTCTGTTGTGAAGGAGACGAGAGATTGCTCGTTGCTGAGTTTATGCCTTTTGAAACTCTCTCGAAGCATCTCTTTCACTGGGATAGTCAGCCAATGAAGTGGTCTATGAGGTTGAGAGTGGCTTTGTATCTTGCACAAGCACTTGAGTATTGTAGCAGCAAAGGTCGCGCCTTGTACCACGATCTTAATGCTTACAGGATCTTGTTTGACCAGGATGGTAACCCGAGATTATCTTGCTTTGGTCTTATGAAGAATAGTAGGGATGGGAAGAGTTACAGTACAAATTTGGCTTTCACACCTCCTGAATACCTAAGAACAGGGAGAGTGATTCCGGAGAGTGTGGTCTACAGCTTCGGAACGCTGTTGCTAGATCTTCTCAGCGGCAAACACATACCACCAAGCCATGCGCTTGATCTGATTCGTGGGAAGAATTTCCTGATGCTGATGGACTCGTGTCTAGATGGCCATTTCTCAAACGATGATGGAACCGATTTGGTTCGTTTAGCTTCCCGTTGTTTGCAGTATGAAGCTCGTGAAAGGCCAAATGTGAAATCTCTCGTGTCCTCACTCGCTCCTCTTCAGAAAGAAACTGATATTCCGTCTCATGTTTTAATGGGGATTCCACATGGAGCTGCTTCTCCAAAGGAAACAACTTCGCTTACCCCTCTTGGTGACGCTTGTTCACGACATGATCTCACAGCAATACATGAAATTCTCGAAAAGGTTGGATACAAAGATGACGAGGGTGTAGCAAATGAGCTCTCGTTCCAAGTGTGGACCGACCAGATTCAGGAGACTCTAAACTCCAAGAAACAAGGAGATGCTGCGTTCAAAGGCAAAGACTTTGTCACTGCTGTTGAATGTTACACGCAGTTCATCGAAGATGGCACAATGGTATCGCCAACAGTTTTTGCAAGGAGGTGTTTGTGTTATCTGATGAGCAATATGCCTCAAGAGGCTCTTGGTGATGCAATGCAGGCGCAAGTAGTGTCTCCTGAATGGCCAACGGCTTTCTATCTTCAGGCCGCTGCTCTCTTCAGCCTTGGAATGGATAAAGACGCCTGTGAAACCCTAAAAGATGGAACTTCCTTGGAAGCCAAGAAACATAACAACAGAAACTGAAAACTTCAAGTGTATAGGTTTCTTCTCTCTTCCGCCTTCTTCGTTTTGTGATTGGATTCTGAGAAAGCCTCATTGTCTCTGTCTTCTTTAAGCATTATCTTAAATTTGTGGTTTCCAATTTGAAGAGATGATTCAAATCACATTTGAATCAAGAAAAGAAGGATCTTTCTCATTTAAGTCCAAGATCCTTATATGAGATTTGTTCAAACT


Protein sequences

Name Description Sequence
At.21094 translated coding region predicted by ESTScan from UniGene At.21094

TDDLPSFTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPLQKETDIPSHVLMGIPHGAASPKETTSLTPLGDACSRHDLTAIHEILEKVGYKDDEGVANELSFQVWTDQIQETLNSKKQGDAAFKGKDFVTAVECYTQFIEDGTMVSPTVFARRCLCYLMSNMPQEALGDAMQAQVVSPEWPTAFYLQAAALFSLGMDKDACETLKDGTSLEAKKHNNRN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF457
1-352 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

TDDLPSFTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPLQKETDIPSHVLMGIPHGAASPKETTSLTPLGDACSRHDLTAIHEILEKVGYKDDEGVANELSFQVWTDQIQET

HMMPanther: PTHR24420
1-352 FAMILY NOT NAMED,FAMILY NOT NAMED

TDDLPSFTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPLQKETDIPSHVLMGIPHGAASPKETTSLTPLGDACSRHDLTAIHEILEKVGYKDDEGVANELSFQVWTDQIQET

Gene3D: G3DSA:3.30.200.20
7-87 no description

FTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGF

superfamily: SSF56112
IPR011009
7-296 Protein kinase-like (PK-like)
Protein kinase-like domain

FTEFSFDQLRAATCGFSTDSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPLQKETDIPSHVLMGIPHG

ProfileScan: PS50011
IPR000719
25-291 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPLQKETDIPSHVLM

HMMSmart: SM00220
IPR002290
25-279 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

DSIVSEHGVKAPNVVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSLAPL

HMMSmart: SM00219
IPR020635
38-276 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VVYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSL

HMMPfam: PF07714
IPR001245
39-276 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VYKGRLEDDRWIAVKRFNRSAWPDTRQFLEEAKAVGQLRNERLANLIGFCCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSL

Gene3D: G3DSA:1.10.510.10
88-276 no description

CCEGDERLLVAEFMPFETLSKHLFHWDSQPMKWSMRLRVALYLAQALEYCSSKGRALYHDLNAYRILFDQDGNPRLSCFGLMKNSRDGKSYSTNLAFTPPEYLRTGRVIPESVVYSFGTLLLDLLSGKHIPPSHALDLIRGKNFLMLMDSCLDGHFSNDDGTDLVRLASRCLQYEARERPNVKSLVSSL

superfamily: SSF48452
350-459 TPR-like

QETLNSKKQGDAAFKGKDFVTAVECYTQFIEDGTMVSPTVFARRCLCYLMSNMPQEALGDAMQAQVVSPEWPTAFYLQAAALFSLGMDKDACETLKDGTSLEAKKHNNRN

Gene3D: G3DSA:1.25.40.10
IPR011990
355-453 no description
Tetratricopeptide-like helical

SKKQGDAAFKGKDFVTAVECYTQFIEDGTMVSPTVFARRCLCYLMSNMPQEALGDAMQAQVVSPEWPTAFYLQAAALFSLGMDKDACETLKDGTSLEAK

HMMPfam: PF13414
356-418 TPR_11,TPR repeat

KKQGDAAFKGKDFVTAVECYTQFIEDGTMVSPTVFARRCLCYLMSNMPQEALGDAMQAQVVSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox