PRGDB00066026 (At.21114)

From PRG Wiki
Jump to: navigation, search
At.21114
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21539486 (AY120738)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana tRNA intron endonuclease-like protein (At5g60300) mRNA, complete cds

DNA Sequence

GTCAGAATATTTTGAAAATCACGTTGAAGCTTTATGGTTATCTTTTTAATATAATCGTGTTAGTGGAGTACAGTTTGTAAAGCAAAGCTTGCGAGGTTATGATTCATCATCAGATCCAGACTCTCTGATTCATCATCTGCAATGGCTCGTTGGTTGCTTCAGATCCTGATCATCTCTTCTCTTCATCTGAGCTCTGTATCAAGTCAACAAGAGACAAGCTTTGTCTATGAAAGCTTCCTCGACCGACAAAATCTTTATCTTGACAAATCTGCAATAGTACTTCCCAGTGGATTATTGCAGTTGACAAATGCTTCAGAGCACCAGATGGGTCATGCTTTCCACAAGAAACCAATTGAGTTCAGTTCATCTGGACCACTCTCCTTCTCAACACACTTTGTGTGTGCTTTGGTGCCTAAGCCAGGTTTTGAAGGTGGCCATGGTATTGTCTTTGTATTGTCTCCTTCTATGGACTTTACTCACGCAGAATCAACTAGATACTTGGGGATTTTCAATGCTTCAACAAATGGATCTTCCTCTTATCACGTACTTGCTGTTGAGCTTGACACTATTTGGAACCCAGATTTCAAAGATATTGACCACAATCATGTGGGGATTGATGTGAACAGTCCTATATCTGTCGCAATAGCTTCAGCATCTTACTATTCCGACATGAAAGGGAGTAATGAAAGCATAAACCTCTTGAGTGGAAACCCTATACAGGTCTGGGTGGATTATGAAGGCACTTTGCTCAATGTTTCGGTTGCTCCTCTTGAAGTCCAGAAGCCAACTCGACCTCTTTTATCACACCCCATCAACCTTACAGAACTTTTTCCAAATAGATCAAGTCTGTTTGCTGGGTTCTCTGCAGCAACAGGGACAGCGATAAGTGATCAATATATTCTCTGGTGGAGTTTTAGCATAGACAGAGGATCGCTGCAGCGACTTGATATCTCAAAACTTCCTGAAGTTCCTCATCCTAGAGCTCCACATAAGAAAGTATCTACACTGATTATTCTCCTACCCGTTTGTCTGGCTATTTTGGTGTTGGCTGTTCTTGCAGGACTTTATTTCCGCAGGAGACGCAAGTATTCAGAAGTATCTGAAACATGGGAAAAGGAGTTTGATGCGCATCGGTTCTCTTACAGGTCCTTGTTCAAAGCAACAAAGGGGTTCAGCAAAGATGAATTTCTGGGAAAAGGAGGTTTTGGAGAAGTTTATAGAGGAAATCTCCCACAAGGCAGAGAAATAGCAGTGAAAAGAGTGTCCCATAATGGTGATGAAGGTGTGAAGCAGTTTGTGGCTGAAGTCGTGAGCATGAGATGTCTGAAACACAGGAATCTTGTACCACTGTTTGGGTATTGCAGAAGAAAACGAGAACTTCTTCTTGTCTCAGAGTACATGCCCAATGGTAGTCTTGACGAGCATTTGTTTGATGACCAGAAACCGGTTCTTTCTTGGTCACAGAGACTTGTGGTCGTTAAGGGTATAGCCTCTGCTCTCTGGTACCTGCATACAGGTGCTGACCAAGTTGTTCTGCACCGAGATGTCAAAGCTTCCAACATTATGTTAGACGCGGAGTTCCATGGAAGGTTAGGGGATTTTGGCATGGCCAGGTTTCATGAGCACGGAGGCAATGCAGCTACAACAGCAGCTGTTGGGACTGTAGGGTACATGGCCCCGGAGCTAATCACAATGGGAGCTTCCACTGGAACTGATGTTTACGCATTTGGTGTTTTCATGCTTGAAGTAACCTGTGGGAGGAGACCCGTGGAACCGCAGTTGCAAGTTGAGAAACGACATATGATCAAATGGGTTTGTGAGTGCTGGAAAAAGGATTCTTTGCTTGATGCTACTGACCCGAGATTGGGAGGTAAATTTGTAGCTGAGGAAGTCGAGATGGTTATGAAACTGGGTCTGCTCTGTTCAAATATAGTGCCAGAATCCAGACCCACAATGGAACAAGTGGTCCTGTACCTAAACAAAAACCTACCTTTGCCAGATTTCTCACCATACACTTTGGGGATTGGCACATTTGCTCCGGTTCTGGTAGATGCATCCTCCCTTGTAGTCTCTTCCGCTTCATGGAGTTTGTCAGGTCCATCGATGTCTTCATCCTCGCCCAACCACTCACCTTACGCTTGGCAGTCAACAGATCAGCCATGGGGACAGACAATAGACACTAAGAACTCTCTTCACATAGTTGCAGAACCAGAGAAGCCCTCACCCGCTGTCAAAATGGTCACATTGCCTGCAGAAGATCCTCAGTCCAATCATTCCAGCATCAGCAGTCAGAGGTAAATTAGTGATGTACATATCAGCAAGAAGATATCATTATTAGCTCTCAATATTGTTTTCATCTGTCTCACTTGTCGCAACAAAATCTGTTTGTTCGTTGTATAATCAGTTAATGATTATACAATTCTCATATTACAACTTGTACTCCTCAATATGATTTTATACATGATTTGGTCCATATTTGGGTTCAATaaaaaaaaaaaGAACTTTTGGT


Protein sequences

Name Description Sequence
At.21114 translated coding region predicted by ESTScan from UniGene At.21114

MARWLLQILIISSLHLSSVSSQQETSFVYESFLDRQNLYLDKSAIVLPSGLLQLTNASEHQMGHAFHKKPIEFSSSGPLSFSTHFVCALVPKPGFEGGHGIVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFSIDRGSLQRLDISKLPEVPHPRAPHKKVSTLIILLPVCLAILVLAVLAGLYFRRRRKYSEVSETWEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPYTLGIGTFAPVLVDASSLVVSSASWSLSGPSMSSSSPNHSPYAWQSTDQPWGQTIDTKNSLHIVAEPEKPSPAVKMVTLPAEDPQSNHSSISSQR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:2.60.120.200
IPR013320
23-277 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

QETSFVYESFLDRQNLYLDKSAIVLPSGLLQLTNASEHQMGHAFHKKPIEFSSSGPLSFSTHFVCALVPKPGFEGGHGIVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFSIDRGSLQRLDISKLPEVP

HMMPfam: PF00139
IPR001220
24-259 Lectin_legB
Legume lectin, beta chain

ETSFVYESFLDRQNLYLDKSAIVLPSGLLQLTNASEHQMGHAFHKKPIEFSSSGPLSFSTHFVCALVPKPGFEGGHGIVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFS

superfamily: SSF49899
IPR008985
24-262 ConA_like_lec_gl
Concanavalin A-like lectin/glucanase

ETSFVYESFLDRQNLYLDKSAIVLPSGLLQLTNASEHQMGHAFHKKPIEFSSSGPLSFSTHFVCALVPKPGFEGGHGIVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFSIDR

HMMPanther: PTHR24420:SF611
101-718 PTHR24420:SF611

IVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFSIDRGSLQRLDISKLPEVPHPRAPHKKVSTLIILLPVCLAILVLAVLAGLYFRRRRKYSEVSETWEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPYTLGIGTFAPVLVDASSLVVSSASWSLSGPSMSSSSPNHSPYAWQSTDQPWGQTIDTKNSLHIVAEPEKPSPAVKMVTLPAEDPQSNHSSISSQR

HMMPanther: PTHR24420
101-718 PTHR24420,FAMILY NOT NAMED

IVFVLSPSMDFTHAESTRYLGIFNASTNGSSSYHVLAVELDTIWNPDFKDIDHNHVGIDVNSPISVAIASASYYSDMKGSNESINLLSGNPIQVWVDYEGTLLNVSVAPLEVQKPTRPLLSHPINLTELFPNRSSLFAGFSAATGTAISDQYILWWSFSIDRGSLQRLDISKLPEVPHPRAPHKKVSTLIILLPVCLAILVLAVLAGLYFRRRRKYSEVSETWEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPDFSPYTLGIGTFAPVLVDASSLVVSSASWSLSGPSMSSSSPNHSPYAWQSTDQPWGQTIDTKNSLHIVAEPEKPSPAVKMVTLPAEDPQSNHSSISSQR

PatternScan: PS00307
IPR019825
136-142 LECTIN_LEGUME_BETA
Legume lectin, beta chain, Mn/Ca-binding site

LAVELDT

superfamily: SSF56112
IPR011009
314-620 Kinase_like
Protein kinase-like domain

RKYSEVSETWEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNLPLPD

Gene3D: G3DSA:3.30.200.20
323-412 G3DSA:3.30.200.20

WEKEFDAHRFSYRSLFKATKGFSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRE

ProfileScan: PS50011
IPR000719
344-616 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVVLYLNKNL

HMMPfam: PF00069
IPR017442
346-608 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KDEFLGKGGFGEVYRGNLPQGREIAVKRVSHNGDEGVKQFVAEVVSMRCLKHRNLVPLFGYCRRKRELLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQV

PatternScan: PS00107
IPR017441
350-372 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGGFGEVYRGNLPQGREIAVK

Gene3D: G3DSA:1.10.510.10
413-609 G3DSA:1.10.510.10

LLLVSEYMPNGSLDEHLFDDQKPVLSWSQRLVVVKGIASALWYLHTGADQVVLHRDVKASNIMLDAEFHGRLGDFGMARFHEHGGNAATTAAVGTVGYMAPELITMGASTGTDVYAFGVFMLEVTCGRRPVEPQLQVEKRHMIKWVCECWKKDSLLDATDPRLGGKFVAEEVEMVMKLGLLCSNIVPESRPTMEQVV

PatternScan: PS00108
IPR008271
464-476 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHRDVKASNIML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox