PRGDB00066027 (At.21118)

From PRG Wiki
Jump to: navigation, search
At.21118
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145335966 (NM_101979)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana WAK2; ATP binding

DNA Sequence

AGGAGATTAGCGAAAACTCAAAACAGGAACAAAGTTaaaagagtgagagagaaagaaagagagaagaTGAAGGTACAGGAGGGTTTGTTCGTGGTGGCTGTTTTCTACCTTGCTTATACGCAGCTAGTCAAGGGGCAACCTCGCAAGGAGTGCCAAACTAGATGTGGCAATGTCGCAGTTGAGTACCCTTTTGGTACTTCTCCAGGTTGTTACTATCCCGGAGATGAAAGTTTCAATCTTACTTGCAACGAGCAAGAGAAGCTCTTCTTTGGCAACATGCCAGTCATCAACATGTCTCTCAGCGGCCAGCTTCGTGTTCGGCTAGTTAGATCCAGAGTTTGCTACGATAGTCAAGGAAAACAGACTGACTACATTGCCCAGCGGACCACCCTGGGTAATTTCACTCTCTCTGAACTTAACAGATTTACTGTAGTAGGTTGTAACAGTTACGCATTTCTCCGCACATCTGGAGTTGAAAAATACTCAACTGGATGCATATCAATATGTGATTCTGCCACAACGAAAAACGGATCATGTTCTGGTGAAGGTTGCTGCCAGATCCCTGTCCCTAGAGGATACTCTTTTGTCAGAGTAAAACCACATAGCTTTCACAACCATCCTACTGTGCATCTGTTTAATCCTTGCACCTACGCCTTTCTCGTTGAAGATGGTATGTTTGACTTCCATGCTTTGGAAGATCTCAACAATCTGCGAAATGTTACTACGTTCCCTGTAGTACTAGATTGGTCTATCGGAGACAAGACTTGCAAACAAGTAGAATACAGGGGCGTGTGTGGTGGTAACAGCACATGTTTCGATTCTACTGGTGGAACCGGGTATAACTGCAAATGTTTAGAAGGTTTTGAGGGGAATCCATACCTTCCAAACGGTTGTCAAGACATCAATGAATGTATTAGTAGTAGACATAACTGTTCGGAGCATAGTACCTGTGAAAACACGAAGGGGAGCTTCAACTGTAACTGCCCATCTGGTTACCGCAAAGATTCCCTTAATAGCTGTACTCGTAAAGTCAGGCCTGAATACTTTAGATGGACTCAAATTTTTCTTGGAACCACCATCGGCTTCTCGGTTATCATGCTTGGGATTAGCTGTCTACAACAGAAAATTAAGCACCGGAAGAACACAGAGCTCCGACAAAAATTCTTCGAGCAAAATGGTGGAGGCATGTTGATACAGCGAGTCTCGGGAGCAGGGCCATCAAATGTTGATGTCAAAATCTTCACTGAGAAAGGAATGAAGGAAGCAACTAATGGTTACCATGAGAGCAGAATCCTGGGTCAGGGAGGCCAAGGAACAGTGTACAAAGGGATATTGCCGGACAACTCCATAGTTGCTATAAAGAAAGCTCGGCTTGGAAACCGTAGCCAAGTAGAGCAGTTCATCAACGAAGTGCTAGTGCTTTCACAAATCAACCATAGGAACGTGGTCAAGGTCTTGGGGTGTTGTTTAGAGACAGAAGTCCCCTTGTTGGTCTATGAGTTCATTAACAGTGGTACCCTTTTCGATCACTTGCACGGTTCCTTGTATGATTCTTCACTTACATGGGAGCACCGTCTGAGGATAGCAACAGAAGTAGCAGGAAGTCTTGCATATCTTCACTCTTCTGCTTCTATTCCAATCATCCACCGAGATATCAAGACTGCTAATATTCTCCTGGATAAAAACTTAACTGCAAAAGTAGCTGACTTTGGTGCATCAAGATTGATACCGATGGATAAAGAGCAGCTCACAACAATAGTGCAAGGCACTCTAGGTTACCTAGACCCAGAATATTACAACACAGGGTTGTTAAACGAAAAGAGCGATGTTTATAGTTTTGGGGTCGTCCTAATGGAACTGCTCTCAGGTCAAAAGGCATTGTGTTTCGAAAGACCACATTGCCCAAAAAATCTTGTGAGTTGTTTTGCTTCTGCCACAAAGAATAATAGGTTCCATGAAATTATTGATGGGCAAGTGATGAATGAGGATAACCAGAGAGAGATCCAGGAAGCTGCAAGAATTGCTGCAGAGTGTACAAGGCTAATGGGAGAGGAAAGGCCAAGGATGAAAGAAGTAGCTGCAGAGTTAGAGGCCTTGAGAGTTAAAACAACTAAATATAAGTGGTCGGATCAGTATCGTGAGACAGGGGAGATTGAACACTTGCTCGGCGTTCAAATCTTGTCAGCACAAGGCGAAACCAGTAGCAGCATTGGCTATGACAGCATCAGAAATGTAACAACATTGGACATTGAAGCTGGCCGTTGATATTAATGCTCTGACAAAATCACATGTATATCTTTTGTTTGTAAAAAAAGAAAGTCATTTCCTTGTTGCTTCATCAATAATGCTTTGACAGATTTGTTTGTACATCATCAATAATCATGTTCATATTTTCCTTTACTTGGTATACTAACCAGTAACCGATCTGGTTATTGGCAAATTTAAAACTCTTGTGTTAAATTTTAGTTC


Protein sequences

Name Description Sequence
At.21118 translated coding region predicted by ESTScan from UniGene At.21118

RRLAKTQNRNKVKRVREKEREKMKVQEGLFVVAVFYLAYTQLVKGQPRKECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQEKLFFGNMPVINMSLSGQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSELNRFTVVGCNSYAFLRTSGVEKYSTGCISICDSATTKNGSCSGEGCCQIPVPRGYSFVRVKPHSFHNHPTVHLFNPCTYAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCTRKVRPEYFRWTQIFLGTTIGFSVIMLGISCLQQKIKHRKNTELRQKFFEQNGGGMLIQRVSGAGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEALRVKTTKYKWSDQYRETGEIEHLLGVQILSAQGETSSSIGYDSIRNVTTLDIEAGR

Domains

Domain Start-End Description Sequence

Seg: seg
11-25 seg

KVKRVREKEREKMKV

HMMPfam: PF13947
IPR025287
49-148 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

KECQTRCGNVAVEYPFGTSPGCYYPGDESFNLTCNEQEKLFFGNMPVINMSLSGQLRVRLVRSRVCYDSQGKQTDYIAQRTTLGNFTLSELNRFTVVGCN

HMMPanther: PTHR24420:SF444
217-749 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCTRKVRPEYFRWTQIFLGTTIGFSVIMLGISCLQQKIKHRKNTELRQKFFEQNGGGMLIQRVSGAGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEALRVKTTKYKWSDQYRETGEIEHLLGVQILSAQGETSSSIGYDSIRNVTTLD

HMMPanther: PTHR24420
217-749 FAMILY NOT NAMED,FAMILY NOT NAMED

YAFLVEDGMFDFHALEDLNNLRNVTTFPVVLDWSIGDKTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCTRKVRPEYFRWTQIFLGTTIGFSVIMLGISCLQQKIKHRKNTELRQKFFEQNGGGMLIQRVSGAGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEALRVKTTKYKWSDQYRETGEIEHLLGVQILSAQGETSSSIGYDSIRNVTTLD

ProfileScan: PS50026
IPR000742
252-299 EGF_3
Epidermal growth factor-like, type 3

GDKTCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQ

HMMSmart: SM00181
IPR006210
255-299 Epidermal growth factor-like domain.
Epidermal growth factor-like

TCKQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQ

superfamily: SSF57196
257-301 EGF/Laminin

KQVEYRGVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDI

Gene3D: G3DSA:2.10.25.10
263-336 no description

GVCGGNSTCFDSTGGTGYNCKCLEGFEGNPYLPNGCQDINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDS

PatternScan: PS01187
IPR018097
300-326 EGF_CA
EGF-like calcium-binding, conserved site

DINECISSRHNCSEHSTCENTKGSFNC

HMMPfam: PF07645
IPR013091
300-340 EGF_CA
EGF calcium-binding

DINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSC

ProfileScan: PS50026
IPR000742
300-341 EGF_3
Epidermal growth factor-like, type 3

DINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCT

HMMSmart: SM00179
IPR001881
300-341 Calcium-binding EGF-like domain
EGF-like calcium-binding

DINECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCT

superfamily: SSF57196
303-342 EGF/Laminin

ECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCTR

HMMSmart: SM00181
IPR006210
303-341 Epidermal growth factor-like domain.
Epidermal growth factor-like

ECISSRHNCSEHSTCENTKGSFNCNCPSGYRKDSLNSCT

PatternScan: PS00010
IPR000152
317-328 ASX_HYDROXYL
EGF-type aspartate/asparagine hydroxylation site

CENTKGSFNCNC

PatternScan: PS01186
IPR013032
326-340 EGF_2
EGF-like region, conserved site

CNCPSGYRKDSLNSC

superfamily: SSF56112
IPR011009
398-719 Protein kinase-like (PK-like)
Protein kinase-like domain

IQRVSGAGPSNVDVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEALRVKTTKYKWSDQYRETGEIE

Gene3D: G3DSA:3.30.200.20
410-487 no description

DVKIFTEKGMKEATNGYHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLG

HMMPfam: PF00069
IPR017442
426-693 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVA

ProfileScan: PS50011
IPR000719
426-699 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

YHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEAL

HMMSmart: SM00219
IPR020635
426-696 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAEL

HMMSmart: SM00220
IPR002290
426-699 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

YHESRILGQGGQGTVYKGILPDNSIVAIKKARLGNRSQVEQFINEVLVLSQINHRNVVKVLGCCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAELEAL

Gene3D: G3DSA:1.10.510.10
488-696 no description

CCLETEVPLLVYEFINSGTLFDHLHGSLYDSSLTWEHRLRIATEVAGSLAYLHSSASIPIIHRDIKTANILLDKNLTAKVADFGASRLIPMDKEQLTTIVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFERPHCPKNLVSCFASATKNNRFHEIIDGQVMNEDNQREIQEAARIAAECTRLMGEERPRMKEVAAEL

PatternScan: PS00108
IPR008271
547-559 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKTANILL

Seg: seg
665-677 seg

QREIQEAARIAAE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox