PRGDB00066028 (At.21129)

From PRG Wiki
Jump to: navigation, search
At.21129
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30695532 (NM_104235)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana MAP3KA; ATP binding

DNA Sequence

GATGAAATCTTCATCTTTCGTATCTCTCCTCCTTCTCATGCCCTAAATTTCATCTCCTCTCTTGTATTGATTCTGTTAAAAATCTCACCTTTCAATTCAAAACCCCTTCCATTTTTGTGATTAATATGCCTACTTGGTGGGGAAGAAAGTCCTGCAAGAACAAGGACGATAATCACAGAGGAATCATCTCCACAGATAGAGATATCAAGAGCTCTGCTGTTGTTGTTGATCCTCCTCTCACTCCTACTCGTGGTGGTACACCTCGTTGCAGTCGTGAATTCGCTGGAGCTTCTTCTGCTTTCTCTGGTTTTGACTCTGATTCTACCGAGAAGAAAGGTCACCCTCTTCCTCGTCCTTTGCTCTCTCCTGTTTCGATCCATCATCAAGATCATGTAAGCGGATCCACTTCTGGATCTACATCTGTTTCTAGCGTTAGCTCATCTGGATCAGCTGATGATCAGAGTCAACTTGTTGCTTCTAGGGGTCGTGGTGATGTGAAATTCAATGTAGCAGCAGCACCACGTAGTCCTGAGAGAGTTTCTCCAAAGGCAGCTACTATTACTACTAGGCCCACGTCTCCACGGCATCAGCGTTTGTCTGGAGTTGTGAGCTTAGAGTCTTCTACAGGGAGGAATGATGATGGAAGGTCCTCCTCTGAGTGTCATCCTTTGCCTCGACCACCTACTTCTCCTACAAGCCCTTCTGCTGTGCATGGTTCCAGGATTGGAGGAGGCTACGAGACCTCTCCTTCGGGGTTTTCCACGTGGAAAAAAGGGAAATTTCTTGGGAGTGGCACCTTTGGTCAAGTCTATCTTGGTTTCAACAGTGAGAAAGGGAAAATGTGTGCTATTAAAGAGGTCAAGGTCATTTCTGACGATCAAACATCAAAAGAATGTCTGAAGCAACTAAATCAGGAGATAAATTTGCTTAACCAGCTTTGTCATCCGAATATTGTCCAGTATTACGGAAGTGAACTGAGTGAAGAAACCTTGTCCGTCTACTTGGAGTACGTGTCAGGTGGTTCAATCCATAAACTACTTAAGGATTATGGTTCTTTCACTGAACCCGTTATCCAAAACTACACGCGGCAGATTCTTGCTGGGCTTGCCTATTTACATGGACGAAATACAGTACATAGGGACATCAAAGGAGCAAATATATTAGTGGATCCGAATGGTGAAATCAAGTTGGCAGACTTTGGGATGGCCAAACATGTAACAGCCTTTTCTACTATGCTTTCTTTTAAAGGGAGTCCTTACTGGATGGCACCCGAGGTTGTGATGAGCCAAAATGGCTACACTCATGCAGTCGATATCTGGAGTTTGGGTTGTACTATTCTGGAAATGGCAACATCAAAGCCACCTTGGAGCCAGTTTGAAGGGGTTGCTGCGATTTTCAAAATCGGAAACAGTAAAGACACCCCGGAAATACCTGATCACCTTTCAAATGATGCAAAGAATTTTATAAGGCTTTGTCTGCAACGAAATCCGACAGTACGTCCTACAGCTTCTCAGCTTCTAGAACACCCTTTTCTACGTAACACAACAAGAGTGGCTAGTACTAGTTTGCCCAAAGACTTCCCCCCACGTTCCTATGATGGAAACTTCTCACTGCAGCCTACAAGGGAACCCTATCCAGGGAGACTGAGCCATGATAATTATGCAAAACAGCCATTGTCTAGAACTATAAAGAGCCCGAGCAGAGAAAACGTAAGAGCTATCACATCCTTACCAGTATCTCCATGTTCAAGCCCTTTACGCCAACTTGGGCCAGCATACAAAAGTTGTTTCCTGTCACCTCCTCACCCGTCTTACGCATTTCCTGGGCAAGACAGTGGGTACAACCTAGCAGAGTTTGCTGCAAGCCCTTTCAGGATGAAGAAAGACGCAATGATGGAACCATCTAGTTTCAGGACTCAAACACCGAATTCACCATTGAGATCAAGACTGGTGTAGAAATGGAGCAAAGATTGAGAGACTGAAAGCCACATACTATAAACAAGGCCCAATGACCATGTATAAAACAGTGTCTACCCCTAGTTTTGGCCTTCTCCTTCTCAACACCCAGGGAAATATGAAGTTATGAGACCTTAGTtgtgtgtgtgtgGAGCATCTCCTAGAAGTGGAGATTTTTGGAACAAGAAGGAGAAATTTGGGGGGAAAACAGAAAGATGTAAAGAGAAACATGAAAATGAATACAAAGTTTATAGAGTGTGAGAAGTATAGATAGTAAGTTGTGTTGTCACACAAAGATAATATTCAACCATTTGTTTTCAACCTACAGTGTGAATATACTTTTCAGAAAGTAAATTAGTTACTCATGTTTGTTTTCCTTT


Protein sequences

Name Description Sequence
At.21129 translated coding region predicted by ESTScan from UniGene At.21129

MPTWWGRKSCKNKDDNHRGIISTDRDIKSSAVVVDPPLTPTRGGTPRCSREFAGASSAFSGFDSDSTEKKGHPLPRPLLSPVSIHHQDHVSGSTSGSTSVSSVSSSGSADDQSQLVASRGRGDVKFNVAAAPRSPERVSPKAATITTRPTSPRHQRLSGVVSLESSTGRNDDGRSSSECHPLPRPPTSPTSPSAVHGSRIGGGYETSPSGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFLRNTTRVASTSLPKDFPPRSYDGNFSLQPTREPYPGRLSHDNYAKQPLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPGQDSGYNLAEFAASPFRMKKDAMMEPSSFRTQTPNSPLRSRLV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24361:SF64
1-584 PTHR24361:SF64

MPTWWGRKSCKNKDDNHRGIISTDRDIKSSAVVVDPPLTPTRGGTPRCSREFAGASSAFSGFDSDSTEKKGHPLPRPLLSPVSIHHQDHVSGSTSGSTSVSSVSSSGSADDQSQLVASRGRGDVKFNVAAAPRSPERVSPKAATITTRPTSPRHQRLSGVVSLESSTGRNDDGRSSSECHPLPRPPTSPTSPSAVHGSRIGGGYETSPSGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFLRNTTRVASTSLPKDFPPRSYDGNFSLQPTREPYPGRLSHDNYAKQPLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPGQDSGYNLAEFAASPFRM

HMMPanther: PTHR24361
1-584 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

MPTWWGRKSCKNKDDNHRGIISTDRDIKSSAVVVDPPLTPTRGGTPRCSREFAGASSAFSGFDSDSTEKKGHPLPRPLLSPVSIHHQDHVSGSTSGSTSVSSVSSSGSADDQSQLVASRGRGDVKFNVAAAPRSPERVSPKAATITTRPTSPRHQRLSGVVSLESSTGRNDDGRSSSECHPLPRPPTSPTSPSAVHGSRIGGGYETSPSGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFLRNTTRVASTSLPKDFPPRSYDGNFSLQPTREPYPGRLSHDNYAKQPLSRTIKSPSRENVRAITSLPVSPCSSPLRQLGPAYKSCFLSPPHPSYAFPGQDSGYNLAEFAASPFRM

superfamily: SSF56112
IPR011009
196-530 Kinase_like
Protein kinase-like domain

HGSRIGGGYETSPSGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFLRNTTRVASTSLPKDFPPRSYDGNFSLQPTREPYPGRLSHDNYAKQPLSRTIKSPSRENVR

Gene3D: G3DSA:3.30.200.20
209-312 G3DSA:3.30.200.20

SGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFT

ProfileScan: PS50011
IPR000719
214-470 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFL

HMMSmart: SM00220
IPR002290
214-470 S_TKc
Serine/threonine-protein kinase domain

WKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFL

HMMPfam: PF00069
IPR017442
215-470 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINLLNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFL

PatternScan: PS00107
IPR017441
220-243 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGTFGQVYLGFNSEKGKMCAIK

Gene3D: G3DSA:1.10.510.10
313-502 G3DSA:1.10.510.10

EPVIQNYTRQILAGLAYLHGRNTVHRDIKGANILVDPNGEIKLADFGMAKHVTAFSTMLSFKGSPYWMAPEVVMSQNGYTHAVDIWSLGCTILEMATSKPPWSQFEGVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRNPTVRPTASQLLEHPFLRNTTRVASTSLPKDFPPRSYDGNFSLQPTREP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox