PRGDB00066029 (At.21169)

From PRG Wiki
Jump to: navigation, search
At.21169
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 14335071 (AY037215)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana AT5g20050

DNA Sequence

GAAATATTTCGTCTTTGTTCTCGTCACCAGAGTGCTTATCTGAAAGAAATGAAGTCAGAGAAGCTCTAAAAGACCTCTAATGGAGGACAAGAAAGCAAACATAATCGCTACTATATTAATCTTAGCCCTTGTCGTAGTGATAATCGCCGCCCGAGTTTCTCTAAAACTCTCCAAAACATTCTATCTCATAGCCGGCGTCGACATTTCCTTGATCCTCGCCGTGATCTGTTTCCTCATAATCCGTAGCCGTTACAACAAAGAAAGAAAGCTCTTGGTATCAAGATTCGCCTCCGAAGGCAGAGAGCTACGAATCGAGTACAGTTTCTTGAGAAAAGTCGCCGGAGTTCCAACCAAATTCAAGCTCGAAGATCTTGAAGAAGCCACCGATGGATTCAGATCTTTGATCGGAAAAGGCGGTTCCGGTTCGGTGTTTAAAGGAGTTTTGAAAGACGGAAGTCAAGTAGCTGtgaagagaatcgaaggagaagagaaaggagaaagagagTTCAGATCCGAAGTAGCTGCCATAGCTTCCGTTCAGCACAAGAATCTAGTTCGTCTTTACGGTTATTCGTCTTCGACTAGCGCGAATCGTCCGAGATTCCTCGTTTACGATTATATCGTAAACTCGTCTCTCGATATCTGGATTTTTCCGGATAGAGGAAACAGAGGAAGATCCGGAGGAGGATGCTTGTCTTGGGAACAAAGGTACCAAGTTGCTATTGATGTAGCTAAAGCTCTTGCTTATCTTCATCATGATTGTCGATCTAAGATCTTGCATCTCGATGTTAAACCCGAAAACATTCTACTAGACGAGAATTTCCGAGCGGTGGTAACCGATTTCGGACTCTCTAAGCTGATTGCTAGAGATGAGAGCAGAGTACTAACGGATATCCGTGGTACTCGGGGGTATTTAGCCCCCGAGTGGCTTCTTGAACACGGTATTTCGGAGAAATCCGATGTGTATAGCTACGGGATTGTGTTACTAGAGATGATCGGAGGACGGAGAAGCATTTCAAGGGTAGAAGTTAAGGAAACAAAAAAGAAGAAATTAGAGTATTTCCCAAGGATTGTGAACCAAAAGATGAGAGAAAGAAAGATAATGGAGATTGTTGATCAAAGGCTGATTGAAGTTAATGAGGTAGATGAAGAGGAAGTGATGAAATTGGTGTGTGTGGCTTTGTGGTGTATACAAGAGAAGTCTAAGAAAAGGCCTGATATGACTATGGTTATTGAGATGCTTGAAGGGAGAGTTCCGGTGAACGAGCCACCGGATTCAGATGTTGTTGTGGTCGATCTTTTGGCGGCTGATGATGATGATGCAAGTACCGGTGTTCGACGGGTAGTAAATATCCCGAAATTGCAAATCCATAGGGAGAGGAATTTTCGTTTATCATCCATTTGCTCTAGTATCATATCTCCCATCTCTCCACGCTAGTTATTTTTGTGTGTTCATATTGGTTTTGTTTCAATCAAAAACTGAGTATGTTTGGTGTGTTACTATTAATCAACCTTTGATACGTATAATAAACACAATTTATACC


Protein sequences

Name Description Sequence
At.21169 translated coding region predicted by ESTScan from UniGene At.21169

MEDKKANIIATILILALVVVIIAARVSLKLSKTFYLIAGVDISLILAVICFLIIRSRYNKERKLLVSRFASEGRELRIEYSFLRKVAGVPTKFKLEDLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRVPVNEPPDSDVVVVDLLAADDDDASTGVRRVVNIPKLQIHRERNFRLSSICSSIISPISPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF948
8-452 PTHR24420:SF948

IIATILILALVVVIIAARVSLKLSKTFYLIAGVDISLILAVICFLIIRSRYNKERKLLVSRFASEGRELRIEYSFLRKVAGVPTKFKLEDLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRVPVNEPPDSDVVVVDLLAADDDDASTGVRRVVNIPKLQIHRERNFRLSSICSSIISPISPR

HMMPanther: PTHR24420
8-452 PTHR24420,FAMILY NOT NAMED

IIATILILALVVVIIAARVSLKLSKTFYLIAGVDISLILAVICFLIIRSRYNKERKLLVSRFASEGRELRIEYSFLRKVAGVPTKFKLEDLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRVPVNEPPDSDVVVVDLLAADDDDASTGVRRVVNIPKLQIHRERNFRLSSICSSIISPISPR

superfamily: SSF56112
IPR011009
75-396 Kinase_like
Protein kinase-like domain

ELRIEYSFLRKVAGVPTKFKLEDLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRVPVNE

Gene3D: G3DSA:3.30.200.20
89-181 G3DSA:3.30.200.20

VPTKFKLEDLEEATDGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYI

ProfileScan: PS50011
IPR000719
103-392 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

DGFRSLIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRV

HMMPfam: PF00069
IPR017442
108-385 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LIGKGGSGSVFKGVLKDGSQVAVKRIEGEEKGEREFRSEVAAIASVQHKNLVRLYGYSSSTSANRPRFLVYDYIVNSSLDIWIFPDRGNRGRSGGGCLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVI

PatternScan: PS00107
IPR017441
109-131 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGKGGSGSVFKGVLKDGSQVAVK

Gene3D: G3DSA:1.10.510.10
204-395 G3DSA:1.10.510.10

CLSWEQRYQVAIDVAKALAYLHHDCRSKILHLDVKPENILLDENFRAVVTDFGLSKLIARDESRVLTDIRGTRGYLAPEWLLEHGISEKSDVYSYGIVLLEMIGGRRSISRVEVKETKKKKLEYFPRIVNQKMRERKIMEIVDQRLIEVNEVDEEEVMKLVCVALWCIQEKSKKRPDMTMVIEMLEGRVPVN

PatternScan: PS00108
IPR008271
232-244 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHLDVKPENILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox