PRGDB00066030 (At.21254)

From PRG Wiki
Jump to: navigation, search
At.21254
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145360800 (NM_129522)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana BIK1 (BOTRYTIS-INDUCED KINASE1); kinase (BIK1) mRNA, complete cds

DNA Sequence

CTTCTCCTTCTTCTAGTCACCCCTCGTGCCTCTCTTTAACACCAAACCCAAAACTCCCTTCTCTttcttccttcctctccgatctccgttcacatctctctctcatctttatcttcttctttttttgccttgtgggttgaaagtttctatattttctcttTCTCTTCTGTTTACATAATCCATTTTCAGCTCAAGCAGCTGAAGAATAACGATCAAGAACCAAAAAAGAAGAAAACGAATCTGTTCTTAGCTTTGATGGGTTCTTGCTTCAGTTCTCGAGTCAAAGCAGACATCTTCCACAATGGTAAGAGCAGCGATCTTTATGGTCTAAGTCTCTCAAGTCGGAAATCGTCTTCGACTGTAGCGGCGGCTCAGAAGACGGAAGGGGAGATATTGAGTTCGACCCCTGTCAAAAGCTTCACCTTTAACGAACTCAAACTCGCCACAAGAAACTTCAGACCAGATAGTGTGATCGGAGAAGGTGGCTTTGGTTGTGTCTTTAAAGGCTGGTTAGATGAGTCCACTCTCACTCCGACTAAACCTGGAACCGGTTTGGTCATCGCCGTTAAAAAGCTTAACCAAGAAGGTTTTCAAGGTCACCGTGAATGGCTGACAGAGATCAATTACTTGGGGCAACTGAGTCACCCAAATCTAGTTAAACTGATCGGTTATTGCTTAGAAGATGAACACCGTCTTCTAGTCTACGAGTTTATGCAAAAAGGAAGTCTTGAGAATCATCTATTCAGAAGAGGTGCATATTTTAAGCCACTCCCATGGTTTCTACGGGTCAATGTTGCGCTTGATGCAGCAAAGGGGCTTGCTTTTCTTCACAGCGATCCCGTCAAAGTGATATACCGAGACATTAAAGCCTCGAACATCTTACTTGATGCGGACTACAACGCAAAACTTTCTGACTTTGGACTAGCTAGAGACGGTCCAATGGGTGATTTGAGTTATGTTAGTACAAGGGTCATGGGTACTTATGGGTACGCCGCGCCTGAGTACATGTCATCAGGTCACTTGAATGCAAGAAGCGATGTGTACAGTTTCGGAGTTTTGCTTCTAGAGATTTTATCTGGTAAGCGAGCGTTGGATCATAACAGACCGGCTAAAGAAGAAAACCTTGTGGATTGGGCTCGACCGTACCTCACAAGCAAACGTAAGGTTCTCCTAATCGTGGACAATCGGCTAGACACACAGTACCTACCTGAAGAAGCCGTGAGAATGGCAAGCGTGGCGGTGCAGTGTCTCTCATTTGAACCCAAGTCGCGCCCGACCATGGACCAAGTGGTCCGTGCCTTACAACAACTTCAGGACAACTTGGGAAAACCGAGTCAGACCAATCCGGTTAAGGATACCAAGAAACTTGGTTTTAAAACTGGTACTACTAAGTCATCCGAAAAACGGTTTACACAAAAACCTTTTGGCAGGCACCTTGTGTAGGTCAAGTTGATAACTGAATTCCAGGATGGACATTTTTCCGGCGGTTTACTTGAAACTGCCGATATCCGTTTTCGACGGATTGAATGCGGTTCTGGACAAACCGTGCAGGTCAAGACTAATAAAGGATACATTAAATTTTCCGGTTACATGTCCCATACCCAACCTTAGAGAACATGTGTAGCCTTTAGCTTAGGCTTCCTTGTGTGCTGTTATATTGAGTATATATGAGGTAATTTTTGCCTCTTGTGTTGTAACACTTGTATTTTTGTTCCTTTAACATTTGATGTAGAGATTTTTCCTATATCTTCAGTTTTGAAACCCAAATTTATT


Protein sequences

Name Description Sequence
At.21254 translated coding region predicted by ESTScan from UniGene At.21254

MGSCFSSRVKADIFHNGKSSDLYGLSLSSRKSSSTVAAAQKTEGEILSSTPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPSQTNPVKDTKKLGFKTGTTKSSEKRFTQKPFGRHLVXVKLITEFQDGHFSGGLLETADIRFRRIECGSGQTVQVKTNKGYIKFSGYMSHTQP

Domains

Domain Start-End Description Sequence

Seg: seg
25-34 seg

LSLSSRKSSS

superfamily: SSF56112
IPR011009
39-372 Protein kinase-like (PK-like)
Protein kinase-like domain

AQKTEGEILSSTPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPSQTNPVKDTKKLG

HMMPanther: PTHR24420:SF861
40-361 SUBFAMILY NOT NAMED

QKTEGEILSSTPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPSQ

HMMPanther: PTHR24420
40-361 FAMILY NOT NAMED,FAMILY NOT NAMED

QKTEGEILSSTPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNLGKPSQ

Gene3D: G3DSA:3.30.200.20
49-139 no description

STPVKSFTFNELKLATRNFRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGY

ProfileScan: PS50011
IPR000719
67-356 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNL

HMMSmart: SM00220
IPR002290
67-352 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQL

HMMSmart: SM00219
IPR020635
67-349 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FRPDSVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRAL

HMMPfam: PF07714
IPR001245
71-349 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SVIGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKKLNQEGFQGHREWLTEINYLGQLSHPNLVKLIGYCLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRAL

PatternScan: PS00107
IPR017441
73-106 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGGFGCVFKGWLDESTLTPTKPGTGLVIAVKK

Gene3D: G3DSA:1.10.510.10
140-356 no description

CLEDEHRLLVYEFMQKGSLENHLFRRGAYFKPLPWFLRVNVALDAAKGLAFLHSDPVKVIYRDIKASNILLDADYNAKLSDFGLARDGPMGDLSYVSTRVMGTYGYAAPEYMSSGHLNARSDVYSFGVLLLEILSGKRALDHNRPAKEENLVDWARPYLTSKRKVLLIVDNRLDTQYLPEEAVRMASVAVQCLSFEPKSRPTMDQVVRALQQLQDNL

PatternScan: PS00108
IPR008271
198-210 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDIKASNILL

Seg: seg
366-379 seg

KDTKKLGFKTGTTK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox