PRGDB00066031 (At.21300)

From PRG Wiki
Jump to: navigation, search
At.21300
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 30686285 (NM_129057)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana protein kinase family protein (AT2G35050) mRNA, complete cds

DNA Sequence

ATGGATCAAGCAAAAGGTTATGAACATGTTCGGTATACTGCCCCTGACCCTAGAGATGAGGGACTTGGCTCCATTAATCAAAGGTTTTCCCACGACTCTTCAACTAATGTTAACACTTATGTACGACCTCCAGATTATGGTGTTTCAACCCCTGCTCGGCCAGTGCTAAACTACTCAATACAGACCGGTGAAGAATTTGCTTTTGAGTTTATGAGAGATAGGGTTATTATGAAACCGCAGTTCATCCCAAATGTGTATGGTGAGCACAGTGGTATGCCTGTTTCTGTTAACTTAAGTGCTCTGGGAATGGTTCATCCAATGTCAGAGAGTGGCCCTAACGCTACAGTGCTTAACATAGAAGAAAAACGTCAGAGCTTTGAGCACGAGAGGAAACCCCCTTCTAGAATTGAAGATAAGACCTATCATGAACTGGTCCAGTCAGCCCCAGTTATCTCTTCGAAAAATGATACTGGTCAAAGGCGTCATAGTTTGGTTTCTTCTAGAGCTTCTGATAGCTCTTTGAACCGTGCGAAGTTCTTGTGTAGTTTTGGTGGTAAAGTTATACCCCGCCCCAGAGATCAGAAACTTAGGTATGTAGGTGGTGAAACGCGTATCATACGGATTAGCAAGACTATTTCTTTCCAAGAACTCATGCATAAAATGAAAGAAATATTTCCTGAAGCACGCACCATAAAATATCAGCTGCCAGGAGAGGATCTTGATGCCCTAGTCTCTGTATCTTCTGACGAGGATTTACAAAACATGATGGAAGAATGTATCGTGTTTGGTAATGGAGGATCTGAGAAGCCCAGGATGTTCTTGTTTTCAAGCAGTGATATAGAGGAGGCTCAGTTTGTTATGGAACATGCAGAGGGTGATTCTGAGGTTCAGTATGTTGTTGCTGTCAATGGGATGGATCTAAGTTCACGGAGAAGTTCCCTTGGATTAAGTCCTCCCGGGAACAATTTGGATGAACTACTTCATGGGAATTTTGATAGGAAGATCGATCGGGCTGCTACAGAACCAGCAGTGGCTTCGCTTACTCCCTTAGCAGGTAATGAATCTTTACCAGCGAGCCAAACTTCTCAACCTGTAACAGGATTTTCTACTGGAAATGAGCCATTTTCACAGCCTTATCTAGGACAACAATTGCAGTTCCCCGGACTTGGTAACCACCAAATTTACACGTCAGGTCACATGGCAAGCATAGGCTATATAGATGAGAAGAGGTCTGCTCCTTTACATGTTCAACCACAACCTCATTATATCCCGTATTCTGTGAATCCTGAAACACCTCTTGAAAGCCTGGTGCCCCACTATCCACAAAAACCTGAGCAAGGATTTTTGCGTGAGGAGCAGATCTTTCATGTACAAGATCCAGAAACTTCATCAAAAGAGGCCAAAATGAGAAGAGATGACTCATTTCAGAAGGTAAATGATCATCCTATATCTACTGTCGAGAGCAATCTTTCAGCAAAGGAGCCAAAGATGAGGAGAGAATCCTCAACCCCAAGGGTCAATGAGTATCCTGTTTCTTCTATGCCTAGTGATTTAATAGTCCCAGATGACCTCCCGAAGGAAGAAGCTCCAATTGTCACACAAACATCTAGTTCAACACCAGATCCAAGTTCTTCAACTCTCTCAGAGAAAAGTCTTAGGAAATCCGAGGACCATGTTGAGAACAATCTGTCAGCAAAGGAGCCAAAGATGAGAAAAGAACACTCCACCACAAGGGTCAATGAATATTCCGTTTCCTCTGTATCTAGTGATTCTATGGTCCCAGATCAAGCCCTCAAGGAAGAAGCTCCTATTTCCATGAAGATATCCAATTCAACACCAGATCCAAAATCCTTGGTTTATCCAGAAAAAAGTCTTAGAACATCCCAGGAGAAAACGGGTGCCTTCGATACAACAAATGAAGGCATGAAAAAGAATCAGGACAATCAATTTTGTCTGCTTGGAGGATTCTCAGTATCTGGACATGGTACTTCAAATAATAGTTCATCTAATGTGAGCAATTTCGACCAGCCTGTGACTCAGCAAAGAGTCTTTCATTCTGAGCGAACTGTACGAGATCCAACAGAAACTAACCGTTTGTCTAAATCTGATGATTCCCTTGCTTCTCAATTTGTAATGGCTCAAACAACATCAGATGCTTTCCTGCCTATCAGCGAATCATCTGAAACTTCTCATGAAGCAAATATGGAGTCCCAGAATGTTCATCCTACTGCGCCAGTAATACCAGCTCCTGATAGCATCTGGACAGCCGAGGGTAGTATGTCACAGTCTGaaaaaaaaaaCGTGGAAACTAACACCCCGGAGCATGTAAGTCAGACAGAGACTTCAGCAAAGGCTGTTCCACAAGGACACAATGAGAAGGGGGATATAGTTGTTGATATAAATGATAGGTTTCCTCGTGAGTTTCTTGCTGATATATTAAAAACGAAAGAGTCTCTGAACTTCCCTGGATTAGGGCCATTGCATGCCGATGGAGCTGGTGTGAGTTTAAATATTCAGAATAATGACCCTAAAACTTGGTCGTATTTTCGAAATTTGGCGCAGGATGAGTTTGAGAGGAAGGATCTATCCCTTATGGATCAGGACCACCCTGGATTTCCCACTTCCATGACTAACACCAACGGAGTTCCTATTGATTATAGCTACCCACCATTGCAGTCTGAGAAAGTTGCCTCAAGTCAGATACATCCACAAATCCACTTTGATGGAAATATCAAGCCAGATGTGTCTACCATTACCATACCTGATTTGAACACAGTAGACACACAAGAAGATTACAGTCAGTCACAAATCAAAGGTGCTGAAAGCACGGATGCAACTCTGAATGCTGGAGTTCCTCTTATTGACTTTATGGCTGCGGATAGTGGCATGAGGTCTCTGCAGGTCATTAAAAATGACGACTTGGAAGAACTGAAGGAATTAGGTTCTGGTACTTTTGGAACTGTTTATCACGGAAAATGGAGGGGTACAGATGTTGCTATCAAGCGAATAAAAAGGAGCTGTTTTATTGGTCGTTCATCTGAACAAGAGAGATTGACCTCGGAGTTCTGGCATGAAGCAGAAATTCTTTCAAAGCTTCATCATCCAAATGTTATGGCATTTTACGGCGTAGTGAAAGATGGACCAGGAGGAACTTTAGCTACAGTGACAGAGTACATGGTCAATGGATCGCTCAGGCATGTTCTGCTCAGCAACAGGCACCTTGATCGACGTAAGCGACTTATCATTGCAATGGACGCAGCTTTTGGGATGGAATATTTGCACTCAAAGAGCATAGTGCATTTCGATTTGAAGTGTGATAACTTGCTTGTCAACTTAAAGGATCCCGCCCGTCCCATATGCAAGGTTGGTGATTTTGGTCTGTCAAAGATAAAAAGAAACACTTTGGTCACTGGCGGTGTAAGGGGAACCCTCCCTTGGATGGCTCCCGAGCTACTTAGTGGAAGCAGCAGCAAAGTTTCTGAAAAGGTTGATGTGTTCTCTTTCGGAATTGTCTTATGGGAAATTCTTACCGGTGAGGAACCCTACGCCAATATGCATTATGGGGCAATAATCGGAGGCATAGTGAACAATACATTGAGACCAACCGTGCCAAACTACTGTGACCCGGAGTGGAGAATGCTGATGGAGCAGTGTTGGGCTCCTGACCCATTTGTTCGACCTGCGTTCCCGGAAATAGCCAGACGTCTCCGCACCATGTCCTCCTCTGCGGTCCACACAAAACCACACGCTGTCAACCACCAAATCCACAAGTAATCTATCAATTTATTATTGCTGGTACGTAAATCGTAAAAAATGGTTTGTGTATAAAATATTTCCTTGCTGCTTCTTTCGGATTTGAGTGCTACAGTTTCAAGGATTGGTGTTGATTTGTACAAGAAACCCTAAAAGCACATATTGTATAGCCATTTTCATTATCATTGAGTGTAAGTAAATTGttttttttGGTACAAAGACTTGGACCTTCTTTCAATAAAATAAGATCAATCTAATGT


Protein sequences

Name Description Sequence
At.21300 translated coding region predicted by ESTScan from UniGene At.21300

MDQAKGYEHVRYTAPDPRDEGLGSINQRFSHDSSTNVNTYVRPPDYGVSTPARPVLNYSIQTGEEFAFEFMRDRVIMKPQFIPNVYGEHSGMPVSVNLSALGMVHPMSESGPNATVLNIEEKRQSFEHERKPPSRIEDKTYHELVQSAPVISSKNDTGQRRHSLVSSRASDSSLNRAKFLCSFGGKVIPRPRDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFSSSDIEEAQFVMEHAEGDSEVQYVVAVNGMDLSSRRSSLGLSPPGNNLDELLHGNFDRKIDRAATEPAVASLTPLAGNESLPASQTSQPVTGFSTGNEPFSQPYLGQQLQFPGLGNHQIYTSGHMASIGYIDEKRSAPLHVQPQPHYIPYSVNPETPLESLVPHYPQKPEQGFLREEQIFHVQDPETSSKEAKMRRDDSFQKVNDHPISTVESNLSAKEPKMRRESSTPRVNEYPVSSMPSDLIVPDDLPKEEAPIVTQTSSSTPDPSSSTLSEKSLRKSEDHVENNLSAKEPKMRKEHSTTRVNEYSVSSVSSDSMVPDQALKEEAPISMKISNSTPDPKSLVYPEKSLRTSQEKTGAFDTTNEGMKKNQDNQFCLLGGFSVSGHGTSNNSSSNVSNFDQPVTQQRVFHSERTVRDPTETNRLSKSDDSLASQFVMAQTTSDAFLPISESSETSHEANMESQNVHPTAPVIPAPDSIWTAEGSMSQSEKKNVETNTPEHVSQTETSAKAVPQGHNEKGDIVVDINDRFPREFLADILKTKESLNFPGLGPLHADGAGVSLNIQNNDPKTWSYFRNLAQDEFERKDLSLMDQDHPGFPTSMTNTNGVPIDYSYPPLQSEKVASSQIHPQIHFDGNIKPDVSTITIPDLNTVDTQEDYSQSQIKGAESTDATLNAGVPLIDFMAADSGMRSLQVIKNDDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTMSSSAVHTKPHAVNHQIHK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23257:SF68
69-1243 PTHR23257:SF68,Ser-thr,SERINE/THREONINE PROTEIN KINASE

EFMRDRVIMKPQFIPNVYGEHSGMPVSVNLSALGMVHPMSESGPNATVLNIEEKRQSFEHERKPPSRIEDKTYHELVQSAPVISSKNDTGQRRHSLVSSRASDSSLNRAKFLCSFGGKVIPRPRDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFSSSDIEEAQFVMEHAEGDSEVQYVVAVNGMDLSSRRSSLGLSPPGNNLDELLHGNFDRKIDRAATEPAVASLTPLAGNESLPASQTSQPVTGFSTGNEPFSQPYLGQQLQFPGLGNHQIYTSGHMASIGYIDEKRSAPLHVQPQPHYIPYSVNPETPLESLVPHYPQKPEQGFLREEQIFHVQDPETSSKEAKMRRDDSFQKVNDHPISTVESNLSAKEPKMRRESSTPRVNEYPVSSMPSDLIVPDDLPKEEAPIVTQTSSSTPDPSSSTLSEKSLRKSEDHVENNLSAKEPKMRKEHSTTRVNEYSVSSVSSDSMVPDQALKEEAPISMKISNSTPDPKSLVYPEKSLRTSQEKTGAFDTTNEGMKKNQDNQFCLLGGFSVSGHGTSNNSSSNVSNFDQPVTQQRVFHSERTVRDPTETNRLSKSDDSLASQFVMAQTTSDAFLPISESSETSHEANMESQNVHPTAPVIPAPDSIWTAEGSMSQSEKKNVETNTPEHVSQTETSAKAVPQGHNEKGDIVVDINDRFPREFLADILKTKESLNFPGLGPLHADGAGVSLNIQNNDPKTWSYFRNLAQDEFERKDLSLMDQDHPGFPTSMTNTNGVPIDYSYPPLQSEKVASSQIHPQIHFDGNIKPDVSTITIPDLNTVDTQEDYSQSQIKGAESTDATLNAGVPLIDFMAADSGMRSLQVIKNDDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTMSSSA

HMMPanther: PTHR23257
69-1243 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EFMRDRVIMKPQFIPNVYGEHSGMPVSVNLSALGMVHPMSESGPNATVLNIEEKRQSFEHERKPPSRIEDKTYHELVQSAPVISSKNDTGQRRHSLVSSRASDSSLNRAKFLCSFGGKVIPRPRDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFSSSDIEEAQFVMEHAEGDSEVQYVVAVNGMDLSSRRSSLGLSPPGNNLDELLHGNFDRKIDRAATEPAVASLTPLAGNESLPASQTSQPVTGFSTGNEPFSQPYLGQQLQFPGLGNHQIYTSGHMASIGYIDEKRSAPLHVQPQPHYIPYSVNPETPLESLVPHYPQKPEQGFLREEQIFHVQDPETSSKEAKMRRDDSFQKVNDHPISTVESNLSAKEPKMRRESSTPRVNEYPVSSMPSDLIVPDDLPKEEAPIVTQTSSSTPDPSSSTLSEKSLRKSEDHVENNLSAKEPKMRKEHSTTRVNEYSVSSVSSDSMVPDQALKEEAPISMKISNSTPDPKSLVYPEKSLRTSQEKTGAFDTTNEGMKKNQDNQFCLLGGFSVSGHGTSNNSSSNVSNFDQPVTQQRVFHSERTVRDPTETNRLSKSDDSLASQFVMAQTTSDAFLPISESSETSHEANMESQNVHPTAPVIPAPDSIWTAEGSMSQSEKKNVETNTPEHVSQTETSAKAVPQGHNEKGDIVVDINDRFPREFLADILKTKESLNFPGLGPLHADGAGVSLNIQNNDPKTWSYFRNLAQDEFERKDLSLMDQDHPGFPTSMTNTNGVPIDYSYPPLQSEKVASSQIHPQIHFDGNIKPDVSTITIPDLNTVDTQEDYSQSQIKGAESTDATLNAGVPLIDFMAADSGMRSLQVIKNDDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTMSSSA

HMMSmart: SM00666
IPR000270
191-277 PB1
Phox/Bem1p

PRDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFSS

HMMPfam: PF00564
IPR000270
192-276 PB1
Phox/Bem1p

RDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFS

superfamily: SSF54277
192-287 SSF54277

RDQKLRYVGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMMEECIVFGNGGSEKPRMFLFSSSDIEEAQFVM

Gene3D: G3DSA:3.10.20.240
199-257 G3DSA:3.10.20.240

VGGETRIIRISKTISFQELMHKMKEIFPEARTIKYQLPGEDLDALVSVSSDEDLQNMME

superfamily: SSF56112
IPR011009
960-1234 Kinase_like
Protein kinase-like domain

DSGMRSLQVIKNDDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIAR

Gene3D: G3DSA:3.30.200.20
967-1058 G3DSA:3.30.200.20

QVIKNDDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEY

ProfileScan: PS50011
IPR000719
974-1239 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTM

HMMPfam: PF07714
IPR001245
975-1236 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

EELKELGSGTFGTVYHGKWRGTDVAIKRIKRSCFIGRSSEQERLTSEFWHEAEILSKLHHPNVMAFYGVVKDGPGGTLATVTEYMVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRL

PatternScan: PS00107
IPR017441
980-1001 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGTFGTVYHGKWRGTDVAIK

FPrintScan: PR00109
IPR001245
1056-1069 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYMVNGSLRHVLL

Gene3D: G3DSA:1.10.510.10
1059-1244 G3DSA:1.10.510.10

MVNGSLRHVLLSNRHLDRRKRLIIAMDAAFGMEYLHSKSIVHFDLKCDNLLVNLKDPARPICKVGDFGLSKIKRNTLVTGGVRGTLPWMAPELLSGSSSKVSEKVDVFSFGIVLWEILTGEEPYANMHYGAIIGGIVNNTLRPTVPNYCDPEWRMLMEQCWAPDPFVRPAFPEIARRLRTMSSSAV

FPrintScan: PR00109
IPR001245
1092-1110 TYRKINASE
Serine-threonine/tyrosine-protein kinase

YLHSKSIVHFDLKCDNLLV

PatternScan: PS00108
IPR008271
1098-1110 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHFDLKCDNLLV

FPrintScan: PR00109
IPR001245
1163-1185 TYRKINASE
Serine-threonine/tyrosine-protein kinase

VDVFSFGIVLWEILTGEEPYANM

FPrintScan: PR00109
IPR001245
1207-1229 TYRKINASE
Serine-threonine/tyrosine-protein kinase

CDPEWRMLMEQCWAPDPFVRPAF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox