PRGDB00066033 (At.21383)

From PRG Wiki
Jump to: navigation, search
At.21383
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145358739 (NM_123564)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana WNK8 (WITH NO LYSINE (K) KINASE 8); kinase

DNA Sequence

CCTTTCATTGATTtcatcatcatcatcatcCTTCGTTTTTTCTCTATCGATCTAGCAGATTCTTTCGGGGACCAAAATCAAAATCATGGTGGATCATCAATGGAAGGATTTAATCGGATAAAAGAGAAGAGACGGAATCACGACGGGAGAAGAGATCGGGAAATCGGAAAATCGGAGATGATGGGGATTTCTTTCGCCGCCAAACTCCGTTTCCGATCTCGATTTCGAACTTCTTCAATCGATTCTTATTGCTTCGCTCGTGAGGCTTTCTCCGATTGTATCTCCTCCGTCCATTTCTTCTTCTTATAACCTTTTTCTTTGTAATAACCTCCGTCCTCTTCAGCTTTCTttcttttcatcttcaatctcaccttaaattctccacttttttcttcttctccttctgttctcGATTGCTTTGTTTGTTGTGTTGTGCATACATATATGGCTTCTGGTTCTGGATTTTTAGGTCAGATATCGTCCATGGAAGAGGCTGATTTTGCCGAGAAAGATCCTTCTGGCCGTTACATCAGGTATGATGATGTTCTGGGGAGAGGAGCTTTCAAGACTGTATATAAGGCGTTTGACGAAGTAGACGGGATTGAAGTTGCTTGGAACCTAGTTAGCATTGAAGATGTAATGCAGATGCCTGGTCAACTTGAAAGGCTATATTCTGAAGTTCATCTACTAAAGGCTCTAAAACATGAAAACATCATCAAACTCTTTTACTCTTGGGTTGACGAAAAGAACAAGACTATTAACATGATCACTGAGCTTTTCACCTCTGGTAGTCTCAGGGTATATCGTAAGAAGCATAGGAAGGTTGATCCCAAGGCCATCAAGAACTGGGCAAGGCAGATTCTCAAAGGCCTGAACTATTTGCATTCTCAGAACCCTCCGGTAATTCACCGGGATCTGAAGTGTGACAATATATTTGTCAATGGAAATACTGGAGAGGTCAAAATCGGAGATCTCGGGCTCGCAACTGTACTGCAGCAGCCCACTGCTCGAAGTGTGATAGGTACTCCTGAATTCATGGCACCTGAACTGTATGAAGAGGAATACAATGAGCTTGTGGACATCTATTCTTTTGGCATGTGTATGTTGGAGATGGTAACCTGTGAATATCCATACAACGAGTGCAGAAACCAGGCTCAAATTTATAAAAAGGTCACCTCGAACATAAAGCCTCAGTCTCTTGGCAAAGTTGACGATCCTCAAGTTAGGCAATTTATAGAGAAATGTCTTCTTCCTGCCTCTTCCAGACCAACTGCCCTCGAGCTCTCGAAGGACCCATTCCTTGCAAGGGATGGAGGCAAGGACTCTGCTCTGCTTGCTTCATCAAGCACATCATCTAAATATGTGAGACCACCACAGCTTGAACATCTTCCCATGGATGTGGATCATAACGAGAATAAAAGTGTTTCAAGCAACGAAGACTACCCATGGTCCCAAACCATTGAACTTCAGAGGATTGCAGAGAATAAAGAGTTCAGGTTGAGAGGTGAGAGGAGCGATGATGTCACAGCGTCTATGGTTCTCCGTATTGCTGACCCGTCTGGTAAATGTAGAATCGTACACTTTGCATTCTATCTGGAGTCAGACACAGCAACAGCAATCGCTGAGGAAATGGTTGAGGAACTGCATTTAACTAGCCAAGAGGTCGTTGTGATAGCTGATATGATCGATGACTTCATAATGCAACTTCTCTCTGACCGGACCTCGTCGCATCATAACCAAAACTCTCCACGTCTAACCCATGAGGATCATGAAGCAGCAAATCAGCAAACTGTGAACTCGAAAGATGAAGAAGCTGCAGGACAATCAATGAAGTCAGACATATCAGCAGACTATTACTTTCCCTACTCAGCAAACGACGGAAATGCTGCCATGGAAGCTGGTCGAGATGCAGAGTCGATGAGCTCGTATCTGGATTCTTGCTCAATGATGTCAACCATTTACAATCTTTCCATTTCAGACAATGATTACCCAGAAGATCTCAAGACAGAACTAAACCTGATCGAGTCACAGTTTAACCAGTCCTTCCAAGATCTGCTGAAACTGAAAGAGGATGCAATAGAGAACGCTAAGCGAAAATGGATTACGAAAAAGCAAAAAGCAGTTAACATCTCTTGATTCAAAAGCTCTGTTTTTGATATTTTACTCTTCTTTTGGTCTTCAACTTTGCTGAGATCGGTGTGTTATACATTTGGTGTTTTGGATATATATATTTGATTTGATTTGATACAACAAA


Protein sequences

Name Description Sequence
At.21383 translated coding region predicted by ESTScan from UniGene At.21383

MASGSGFLGQISSMEEADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLARDGGKDSALLASSSTSSKYVRPPQLEHLPMDVDHNENKSVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDYPEDLKTELNLIESQFNQSFQDLLKLKEDAIENAKRKWITKKQKAVNIS

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR13902
11-515 PTHR13902,Ser-thr,SERINE/THREONINE-PROTEIN KINASE WNK (WITH NO LYSINE)-RELATED

ISSMEEADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLARDGGKDSALLASSSTSSKYVRPPQLEHLPMDVDHNENKSVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDY

HMMPanther: PTHR13902:SF39
11-515 PTHR13902:SF39,SUBFAMILY NOT NAMED

ISSMEEADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLARDGGKDSALLASSSTSSKYVRPPQLEHLPMDVDHNENKSVSSNEDYPWSQTIELQRIAENKEFRLRGERSDDVTASMVLRIADPSGKCRIVHFAFYLESDTATAIAEEMVEELHLTSQEVVVIADMIDDFIMQLLSDRTSSHHNQNSPRLTHEDHEAANQQTVNSKDEEAAGQSMKSDISADYYFPYSANDGNAAMEAGRDAESMSSYLDSCSMMSTIYNLSISDNDY

superfamily: SSF56112
IPR011009
16-287 Kinase_like
Protein kinase-like domain

EADFAEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLA

Gene3D: G3DSA:3.30.200.20
20-129 G3DSA:3.30.200.20

AEKDPSGRYIRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDP

ProfileScan: PS50011
IPR000719
29-286 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IRYDDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFL

HMMPfam: PF00069
IPR017442
32-286 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

DDVLGRGAFKTVYKAFDEVDGIEVAWNLVSIEDVMQMPGQLERLYSEVHLLKALKHENIIKLFYSWVDEKNKTINMITELFTSGSLRVYRKKHRKVDPKAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFL

Gene3D: G3DSA:1.10.510.10
130-287 G3DSA:1.10.510.10

KAIKNWARQILKGLNYLHSQNPPVIHRDLKCDNIFVNGNTGEVKIGDLGLATVLQQPTARSVIGTPEFMAPELYEEEYNELVDIYSFGMCMLEMVTCEYPYNECRNQAQIYKKVTSNIKPQSLGKVDDPQVRQFIEKCLLPASSRPTALELSKDPFLA

PatternScan: PS00108
IPR008271
153-165 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKCDNIFV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox