PRGDB00066034 (At.21553)

From PRG Wiki
Jump to: navigation, search
At.21553
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 186490676 (NM_001124007)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein

DNA Sequence

AACtgtttctttcttcttccattttctctctcaatctctctccctctctcaatcttctggtctcgcctcgtcgtctctTGGAGAATTGAGAATTGGGAATCTGTTTTGGTTTTGCCCGAGAAAAAAACGAGAGAGATGGGTTTCATCTTCTCGACCGAGAAAGTTGTGTATGTTCTTCTTCTCATCTTCGTTTGCTTGGAAAATTTCGGATCAAATGCTCAACTTTTGCCTGAAGATGAAGGTTCGTTTCACTATTTTAAATCCACATCTCAACTAAATTTCTTCAATTTTATTTTCAACTCCTCAATTCTACTTAGTTTCGAAGCAAAATAATTTAGATGCTGCTTTACTAAAAAAGAAACTTTTAGAGAAAGAAAGTTATCCTTTAGCAAATTATCGAATTAACTGTATTTTTTGTTGTCCTTGTTCAAAAAATATATGTATATTAAATTCCACGGGAGATTTATGAAGTTGTCAAAAGGTTTTCCATTATTACCTTTTGGTATAAGCGTGATTTTTCTCTAAAAAGTCGCATTTCAAACCTAAGATGGGAATTTTATTTGTGTGGTCATATTTGACAAATAAAAAGCTGGAAAATATTGGATTTATTCAAGTTCGAGGACCTACCTCAATAATTGAATGGTATTGGTCGTCGTAGCTGCACGATGCAAGAGTTAAAAAAATTAGGATGTGTTAATAAACAAATAATTATATCTCAATATGGCAATTCAAACATTGCGAACGATCTTTAGAAAGCTTCAAAACCAAACAGTGAACATCGAAAGAACTTCTTGTTCGGACCAAAACTGGAACTTTGTTGTCGAGTCAGCCTCCAACTCACCAACCAGTAACATTACCTGCGACTGTACTTTCAACGCCAGCTCAGTCTGTCGTGTCACAAACATACAGCTTAAAAGTTTCAGCTTGCCCGGAATATTCCCGCCTGAGTTCGGAAACCTCACGCGTCTTCGAGAGATAGATCTTTCGCGGAACTTTCTCAATGGAACAATACCTACGACATTGTCTCAAATTCCACTTGAAATCTTGTCTGTAATCGGAAACCGTCTCTCAGGACCATTTCCTCCTCAACTTGGAGATATTACTACACTTACTGATGTGAATTTGGAAACTAATTTATTCACAGGACCACTTCCTCGAAACCTAGGGAACTTAAGAAGCTTGAAAGAGTTACTTCTCTCTGCAAACAACTTCACGGGTCAAATCCCTGAGTCCTTAAGTAATCTCAAGAATTTGACTGAATTTCGGATTGATGGAAACTCTCTATCTGGGAAAATACCTGATTTTATTGGAAACTGGACTCTGCTGGAGAGGCTAGACCTTCAAGGCACATCAATGGAAGGTCCAATTCCACCTTCAATATCAAACTTGACGAACTTGACTGAATTGAGGATAACCGATTTGCGTGGACAAGCGGCCTTTTCTTTTCCGGACCTGCGAAATCTAATGAAAATGAAACGATTGGGACCTATCCCGGAATACATTGGTTCCATGAGTGAGCTGAAGACACTAGATTTAAGCTCAAACATGCTAACCGGTGTAATTCCTGACACATTTCGGAATCTCGATGCATTTAACTTTATGTTTTTGAATAATAACTCATTGACTGGTCCAGTTCCTCAGTTCATCATCAACAGTAAAGAAAACCTAGATTTATCTGACAACAATTTCACTCAGCCACCTACTTTAAGCTGTAATCAGCTTGATGTGAACTTGATCTCCAGCTACCCTTCAGTAACCGATAACTCTGTTCAATGGTGCTTGAGAGAGGGTCTTCCATGTCCAGAAGATGCTAAACAGTCTTCCCTGTTCATCAACTGTGGAGGAAGCAGACTCAAGATTGGAAAAGACACTTATACAGATGACTTGAACAGTAGAGGACAATCAACATTCTCTTCTGTCTCTGAAAGATGGGGATACAGTAGTTCTGGAGTTTGGTTAGGCAAGGAGGATGCTGGCTACTTAGCAACAGACAGATTTAACTTGATCAATGGATCAACTCCAGAGTATTACAAAACAGCCCGTCTCTCTCCACAGTCACTCAAGTACTATGGACTATGCTTGAGAAGAGGAAGTTACAAACTGCAGCTACATTTTGCAGAGATAATGTTCTCAAATGACCAGACTTTTAATAGCTTAGGGCGGCGAATATTCGACATTTATGTCCAAGGGAACTTGTTGGAGAGGGACTTTAACATAGCAGAGAGAGCAGGTGGAGTTGGTAAACCGTTCATAAGGCAAATTGATGGAGTTCAAGTGAATGGAAGTACGTTAGAGATTCATTTGCAGTGGACAGGGAAAGGCACAAACGTAATACCAACAAGAGGTGTTTACGGGCCTCTCATATCTGCCATAACCATTACACCAAATTTCAAGGTTGATACCGGAAAACCATTGTCCAATGGAGCAGTTGCAGGCATTGTAATCGCAGCGTGTGCGGTTTTCGGGTTGCTGGTACTTGTAATCTTGAGGCTTACAGGTTACTTAGGTGGAAAAGAAGTAGATGAGAATGAAGAGCTTCGGGGACTTGATTTGCAGACAGGATCGTTCACATTGAAACAAATAAAACGTGCTACTAATAACTTTGATCCAGAAAACAAGATTGGTGAAGGAGGATTTGGACCGGTTTATAAGGGTGTTCTCGCTGATGGGATGACCATAGCGGTGAAGCAGCTTTCATCAAAATCTAAGCAAGGAAACCGAGAATTTGTGACTGAGATCGGTATGATATCTGCGCTGCAACACCCTAATCTTGTGAAACTTTATGGTTGTTGCATCGAAGGGAAAGAGCTCTTGCTTGTGTATGAGTACTTAGAGAACAACAGTCTCGCTCGCGCACTCTTTGGCACAGAGAAACAGAGGCTTCACTTGGATTGGTCAACAAGGAACAAGATTTGCATAGGGATTGCGAAAGGATTGGCCTATCTACACGAGGAATCAAGGCTGAAGATTGTTCATAGAGACATAAAAGCGACAAATGTGCTTCTTGATCTGTCTCTAAACGCTAAGATCTCTGATTTTGGTCTAGCTAAACTCAACGATGACGAGAATACACATATCAGCACAAGGATTGCAGGAACAATAGGTTACATGGCTCCTGAGTATGCAATGAGAGGTTACTTGACAGACAAGGCAGATGTTTACAGCTTTGGTGTTGTCTGTTTAGAGATTGTTAGTGGAAAGAGCAACACAAATTACAGACCAAAGGAAGAGTTTGTTTACCTTCTGGATTGGGCATATGTCTTGCAAGAACAAGGTAGTCTTCTAGAACTCGTTGATCCGGATCTCGGCACAAGCTTTTCGAAGAAAGAAGCGATGAGGATGTTGAACATAGCATTACTCTGCACGAACCCATCTCCAACATTGAGACCACCAATGTCATCTGTTGTAAGTATGTTAGAAGGAAAAATCAAAGTCCAACCACCATTGGTGAAACGTGAAGCAGATCCAAGTGGTTCAGCAGCAATGAGGTTTAAGGCCTTAGAGCTTTTGTCACAAGACAGTGAGTCACAAGTCTCGACATATGCAAGAAACAGAGAGCAAGACATAAGCTCCTCATCGATGGACGGTCCTTGGGTAGATTCTTCCTTCTCTGAGCCTGGGAAAGATGTTAGCCTGCAACAGCAAGAAGAAGGACGTTCATCATCTTCGTCGAGGAAACTTTTAGATGATCTTACCGATGTGAAGATTGAGTAATGAATTTTAAATCTATCAGATTCTTTTATTCAATCTACTAAAACAACACTATTTACCAACAGACCAATCAAATTTTGCTTCTTTTTTTCTTGGTTCAATTCAATCTATAGAATTTACTTGTTGCAATAA


Protein sequences

Name Description Sequence
At.21553 translated coding region predicted by ESTScan from UniGene At.21553

MAIQTLRTIFRKLQNQTVNIERTSCSDQNWNFVVESASNSPTSNITCDCTFNASSVCRVTNIQLKSFSLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMKMKRLGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKENLDLSDNNFTQPPTLSCNQLDVNLISSYPSVTDNSVQWCLREGLPCPEDAKQSSLFINCGGSRLKIGKDTYTDDLNSRGQSTFSSVSERWGYSSSGVWLGKEDAGYLATDRFNLINGSTPEYYKTARLSPQSLKYYGLCLRRGSYKLQLHFAEIMFSNDQTFNSLGRRIFDIYVQGNLLERDFNIAERAGGVGKPFIRQIDGVQVNGSTLEIHLQWTGKGTNVIPTRGVYGPLISAITITPNFKVDTGKPLSNGAVAGIVIAACAVFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKALELLSQDSESQVSTYARNREQDISSSSMDGPWVDSSFSEPGKDVSLQQQEEGRSSSSSRKLLDDLTDVKIE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
3-997 PTHR24420,FAMILY NOT NAMED

IQTLRTIFRKLQNQTVNIERTSCSDQNWNFVVESASNSPTSNITCDCTFNASSVCRVTNIQLKSFSLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMKMKRLGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKENLDLSDNNFTQPPTLSCNQLDVNLISSYPSVTDNSVQWCLREGLPCPEDAKQSSLFINCGGSRLKIGKDTYTDDLNSRGQSTFSSVSERWGYSSSGVWLGKEDAGYLATDRFNLINGSTPEYYKTARLSPQSLKYYGLCLRRGSYKLQLHFAEIMFSNDQTFNSLGRRIFDIYVQGNLLERDFNIAERAGGVGKPFIRQIDGVQVNGSTLEIHLQWTGKGTNVIPTRGVYGPLISAITITPNFKVDTGKPLSNGAVAGIVIAACAVFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKALELLSQDSESQVSTYARNREQDISSSSMDGPWVDSSFSEPGKDVSLQQQEEGRSSSSSRKLLDDLTDVKIE

HMMPanther: PTHR24420:SF697
3-997 PTHR24420:SF697

IQTLRTIFRKLQNQTVNIERTSCSDQNWNFVVESASNSPTSNITCDCTFNASSVCRVTNIQLKSFSLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMKMKRLGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKENLDLSDNNFTQPPTLSCNQLDVNLISSYPSVTDNSVQWCLREGLPCPEDAKQSSLFINCGGSRLKIGKDTYTDDLNSRGQSTFSSVSERWGYSSSGVWLGKEDAGYLATDRFNLINGSTPEYYKTARLSPQSLKYYGLCLRRGSYKLQLHFAEIMFSNDQTFNSLGRRIFDIYVQGNLLERDFNIAERAGGVGKPFIRQIDGVQVNGSTLEIHLQWTGKGTNVIPTRGVYGPLISAITITPNFKVDTGKPLSNGAVAGIVIAACAVFGLLVLVILRLTGYLGGKEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPLVKREADPSGSAAMRFKALELLSQDSESQVSTYARNREQDISSSSMDGPWVDSSFSEPGKDVSLQQQEEGRSSSSSRKLLDDLTDVKIE

Gene3D: G3DSA:3.80.10.10
4-250 G3DSA:3.80.10.10

QTLRTIFRKLQNQTVNIERTSCSDQNWNFVVESASNSPTSNITCDCTFNASSVCRVTNIQLKSFSLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMK

superfamily: SSF52058
44-326 SSF52058,LRR

NITCDCTFNASSVCRVTNIQLKSFSLPGIFPPEFGNLTRLREIDLSRNFLNGTIPTTLSQIPLEILSVIGNRLSGPFPPQLGDITTLTDVNLETNLFTGPLPRNLGNLRSLKELLLSANNFTGQIPESLSNLKNLTEFRIDGNSLSGKIPDFIGNWTLLERLDLQGTSMEGPIPPSISNLTNLTELRITDLRGQAAFSFPDLRNLMKMKRLGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKENLDLSDNNFTQP

HMMPfam: PF00560
IPR001611
153-175 LRR_1
Leucine-rich repeat

SLKELLLSANNFTGQIPESLSNL

Gene3D: G3DSA:3.80.10.10
253-339 G3DSA:3.80.10.10

RLGPIPEYIGSMSELKTLDLSSNMLTGVIPDTFRNLDAFNFMFLNNNSLTGPVPQFIINSKENLDLSDNNFTQPPTLSCNQLDVNLI

HMMPfam: PF00560
IPR001611
267-288 LRR_1
Leucine-rich repeat

LKTLDLSSNMLTGVIPDTFRNL

HMMPfam: PF11721
IPR021720
368-551 Malectin
Malectin

SLFINCGGSRLKIGKDTYTDDLNSRGQSTFSSVSERWGYSSSGVWLGKEDAGYLATDRFNLINGSTPEYYKTARLSPQSLKYYGLCLRRGSYKLQLHFAEIMFSNDQTFNSLGRRIFDIYVQGNLLERDFNIAERAGGVGKPFIRQIDGVQVNGSTLEIHLQWTGKGTNVIPTRGVYGPLISAI

superfamily: SSF56112
IPR011009
598-907 Kinase_like
Protein kinase-like domain

KEVDENEELRGLDLQTGSFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQP

Gene3D: G3DSA:3.30.200.20
615-703 G3DSA:3.30.200.20

SFTLKQIKRATNNFDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEY

ProfileScan: PS50011
IPR000719
628-909 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDPENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQPPL

HMMPfam: PF07714
IPR001245
631-899 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

ENKIGEGGFGPVYKGVLADGMTIAVKQLSSKSKQGNREFVTEIGMISALQHPNLVKLYGCCIEGKELLLVYEYLENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSML

Gene3D: G3DSA:1.10.510.10
704-907 G3DSA:1.10.510.10

LENNSLARALFGTEKQRLHLDWSTRNKICIGIAKGLAYLHEESRLKIVHRDIKATNVLLDLSLNAKISDFGLAKLNDDENTHISTRIAGTIGYMAPEYAMRGYLTDKADVYSFGVVCLEIVSGKSNTNYRPKEEFVYLLDWAYVLQEQGSLLELVDPDLGTSFSKKEAMRMLNIALLCTNPSPTLRPPMSSVVSMLEGKIKVQP

PatternScan: PS00108
IPR008271
750-762 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKATNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox