PRGDB00066048 (At.22084)

From PRG Wiki
Jump to: navigation, search
At.22084
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 145357529 (NM_120273)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana ATP binding

DNA Sequence

ACTGAGAAGAAAGAAAGAAGTTGACTGACATGAGAAGAAAGGGACAAGAGCGCGTCTCGAAACGCCGTCAATGTTGGGTTGCTGATACTAATAAATGCAGGCTAATGGCTAAAGGGGTTTCTTTCTTTCTACTTTCTACTTTACTATTGGTCAAAAAGGCTCACACACACGAGGGTACTTGTGGAGCAGGTAGGTAGAGTCAACCCAGTTCCGAATTATGACCACGGAAGAAGGTTTAAGCTTTTTAAAATGGCAGACAAGTCAAGATCAAACCTAGCAAACACCCATCAAGGGATTTTGCCATCCCAGAAGCTTTCTCTTATCCGCTTGCCTTTTTGGAAAATTCTCTTAGGGAACTAGTACTAGTATTGCTGATCTCAATAGTGAGGCACCATGGTGTTCCCTCAAAGACTCTATCTACATGCGCTCCTTGTTGCCTGTTGTTGCGTCCTTCTGCTTGCCGATGCTCAAAGAACCCACCCTTCAGAAGTCACTGCTTTACGATCTGTTAAAAGAAGTCTACTTGACCCTAAAGATTATTTGAGAAACTGGAATAGAGGCGACCCTTGCAGATCAAATTGGACTGGAGTTATCTGCTTTAATGAGATTGGTACTGACGACTACCTGCATGTCCGAGAACTCCTGCTGATGAATATGAATCTCTCCGGGACTTTGTCACCAGAGCTCCAAAAATTAGCTCATCTCGAAATATTAGATTTCATGTGGAATAATATAAGTGGTTCAATTCCAAACGAGATAGGACAGATATCATCCCTGGTACTCTTGCTGCTGAATGGAAACAAACTTTCAGGGACTTTACCAAGCGAACTCGGGTATCTTTCGAACTTGAACAGGTTCCAGATAGATGAGAATAACATCACAGGACCAATACCAAAGTCCTTTTCCAACTTGAAAAAAGTGAAACATCTTCACTTCAACAATAATTCGTTGACCGGCCAGATTCCAGTTGAGCTTTCCAATCTTACTAACATCTTTCATGTGCTGCTAGACAACAATAAATTATCTGGAAATCTTCCACCACAACTCTCTGCATTGCCAAACCTGCAAATCCTGCAACTTGATAATAACAACTTCAGTGGATCCGATATCCCAGCTTCCTATGGAAACTTTTCGAATATTCTAAAGCTGAGTCTTAGAAATTGTAGTTTGAAAGGGGCACTTCCTGATTTTAGCAAGATACGTCATCTCAAATACTTGGATCTTAGCTGGAATGAACTCACAGGACCTATACCTTCCTCTAATTTTTCTAAGGATGTGACAACCATTAATTTATCAAACAACATACTTAACGGATCCATCCCGCAGAGCTTCTCAGATCTCCCTTTACTTCAGATGCTATTGCTGAAAAACAATATGTTATCTGGATCTGTCCCTGATTCCCTTTGGAAGAATATCTCTTTTCCGAAGAAAGCTAGACTTCTACTTGATCTTAGGAATAATTCTCTGTCACGTGTTCAAGGAGATCTAACTCCTCCACAAAATGTCACTTTAAGGCTTGATGGCAATCTGATCTGCACTAATGGAAGCATATCAAACGCAAACCTATTCTGTGAGTCCAAAGGCAAAGAGTGGATATCACTACCAAACAATTCAACCAATTCTGCACTGGACTGTCCTCCTCTTGCCTGTCCCACTCCTGACTTCTACGAATACAGTCCAGCATCCCCATTACGATGCTTTTGTGCAGCGCCTCTTAGAATTGGATATCGTCTCAAAAGTCCTAGTTTCTCATACTTCCCTCCATATATTGATCAATTTGGCGAGTATGTTACCGATTTCCTTCAAATGGAACCATATCAACTCTGGATCGACTCATATCAATGGGAGAAAGGGCCTCGTCTGAGGATGTATCTGAAACTTTTTCCGAAAGTTAATGAAACCTATACAAGAACATTTAACGAGAGTGAAGTTCTCAGAATCCGAGGCATATTCGCTTCATGGAGATTTCCTGGTAGTGACTTATTTGGCCCGTATGAACTGCTCAACTTCACTCTGCAGGGGCCTTATTCATATGTTAACTTCAACAGTGAAAGGAAAGGCGTCAGCTGGCGACGATTGGCAGCAATAACTGCAGGGGCTGTGGTGACTGCTGTTGCGATATCCGCTGTGGTTGCAGCCTTGTTGCTTAGAAGATACAGCAAGCACGAGCGAGAGATATCTAGAAGACGGTCATCCTCGAAGGCTTCCTTGTTGAATTCTGGGATAAGAGGCTTTAGTTTCAAAGAGCTAGCAGAGGCCACCGACGATTTTAGCAGCTCAACTTTGGTTGGGCGCGGAGGCTATGGAAAGGTTTACAGAGGTGTCTTATCTGACAATACTGTTGCTGCAATAAAGCGAGCAGATGAAGGGTCTTTGCAAGGTGAAAAGGAGTTCTTGAATGAAATAGAGCTGCTCTCGAGGTTGCATCATCGGAATCTTGTGTCACTGATCGGTTACTGTGATGAAGAAAGCGAGCAGATGCTGGTGTACGAATTTATGTCAAATGGCACCCTGCGCGACTGGTTGTCTGCTAAGGGGAAGGAGTCATTGAGCTTTGGGATGAGGATTCGTGTTGCGTTGGGAGCAGCAAAAGGTATTCTCTACCTTCACACAGAAGCCAACCCGCCAGTTTTCCACCGAGACATCAAAGCCAGTAACATCCTCCTCGACCCCAACTTCAATGCCAAAGTTGCAGACTTTGGACTGTCTCGACTTGCTCCTGTTTTGGAGGACGAAGAGGATGTGCCTAAGCACGTCTCAACCGTTGTCCGTGGGACTCCAGGGTACCTGGATCCTGAATATTTCCTGACACACAAGCTGACGGACAAGAGCGATGTTTACAGCATCGGAGTTGTGTTCTTGGAGCTGCTGACTGGTATGCACGCCATATCCCATGGAAAAAATATAGTACGAGAGGTGAAGACGGCTGAGCAGAGGGATATGATGGTATCGCTGATAGACAAGAGAATGGAGCCGTGGTCGATGGAAAGTGTTGAAAAGTTTGCGGCTTTGGCACTGAGGTGTAGCCACGACTCACCAGAGATGAGGCCAGGAATGGCGGAGGTGGTGAAGGAGCTGGAGTCACTGCTCCAAGCATCCCCCGATAGGGAGACAAGAGTGGAATTGGCGTCATCTTCGTCAGTGCTGTCAACATCGTCGTCGAATGTGACAAGAGACCTTTACGAGTCGTCGAGCCTTCTAGGAAGCGATCTCAGCAGCGGCTTTGTTCCCAGCATCGCTCCTCGCTGACTCCAACCATTGCATCTATGTACAAATCTCTATACATATACTTTGACTCCACCTTTCTTACTTTTTAACCAATTAGATATCTTCCAGTTACACTGTAATATATTCTTTTCAAAAATCGTTAATACCAAACTTCGAATC


Protein sequences

Name Description Sequence
At.22084 translated coding region predicted by ESTScan from UniGene At.22084

MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLYESSSLLGSDLSSGFVPSIAPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF772
1-948 PTHR24420:SF772

MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLYESSSLLGSDLSSGFVPSI

HMMPanther: PTHR24420
1-948 PTHR24420,FAMILY NOT NAMED

MVFPQRLYLHALLVACCCVLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCAAPLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFPKVNETYTRTFNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKGVSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVLSTSSSNVTRDLYESSSLLGSDLSSGFVPSI

superfamily: SSF52058
26-288 SSF52058,LRR

QRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPS

Gene3D: G3DSA:3.80.10.10
29-278 G3DSA:3.80.10.10

HPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYLHVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKLSGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLTNIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLS

HMMPfam: PF08263
IPR013210
30-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVIC

HMMPfam: PF00560
IPR001611
176-197 LRR_1
Leucine-rich repeat

VKHLHFNNNSLTGQIPVELSNL

HMMPfam: PF13855
222-282 LRR_8,Leucine rich repeat

PNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNEL

superfamily: SSF52058
237-408 SSF52058,LRR

SDIPASYGNFSNILKLSLRNCSLKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGSISNANLFCESKGKEWISLPNNST

Gene3D: G3DSA:3.80.10.10
279-385 G3DSA:3.80.10.10

WNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPLLQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGNLICTNGS

superfamily: SSF56112
IPR011009
598-918 Kinase_like
Protein kinase-like domain

RRSSSKASLLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELESLLQASPDRETRVELASSSSVL

Gene3D: G3DSA:3.30.200.20
606-687 G3DSA:3.30.200.20

LLNSGIRGFSFKELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIG

ProfileScan: PS50011
IPR000719
626-899 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELESLL

HMMPfam: PF00069
IPR017442
630-893 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

TLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSRLHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVK

PatternScan: PS00107
IPR017441
632-654 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGRGGYGKVYRGVLSDNTVAAIK

Gene3D: G3DSA:1.10.510.10
688-896 G3DSA:1.10.510.10

YCDEESEQMLVYEFMSNGTLRDWLSAKGKESLSFGMRIRVALGAAKGILYLHTEANPPVFHRDIKASNILLDPNFNAKVADFGLSRLAPVLEDEEDVPKHVSTVVRGTPGYLDPEYFLTHKLTDKSDVYSIGVVFLELLTGMHAISHGKNIVREVKTAEQRDMMVSLIDKRMEPWSMESVEKFAALALRCSHDSPEMRPGMAEVVKELE

PatternScan: PS00108
IPR008271
746-758 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VFHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox